Macrotis lagotis (bilby): 141517626 Help Entry 141517626         CDS       T11097                                  Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mlao  Macrotis lagotis (bilby) Pathway mlao04014   Ras signaling pathway mlao04137   Mitophagy - animal mlao04144   Endocytosis mlao04145   Phagosome mlao04148   Efferocytosis mlao04962   Vasopressin-regulated water reabsorption mlao05014   Amyotrophic lateral sclerosis mlao05022   Pathways of neurodegeneration - multiple diseases mlao05132   Salmonella infection mlao05146   Amoebiasis mlao05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mlao00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     141517626  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     141517626    04145 Phagosome     141517626    04137 Mitophagy - animal     141517626    04148 Efferocytosis     141517626  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     141517626  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     141517626    05152 Tuberculosis     141517626   09174 Infectious disease: parasitic    05146 Amoebiasis     141517626   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     141517626    05022 Pathways of neurodegeneration - multiple diseases     141517626  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlao04131]     141517626   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlao04147]     141517626    04031 GTP-binding proteins [BR:mlao04031]     141517626 Membrane trafficking [BR:mlao04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     141517626  Endosome - Lysosome transport     141517626 Exosome [BR:mlao04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    141517626   Exosomal proteins of other body fluids (saliva and urine)    141517626   Exosomal proteins of colorectal cancer cells    141517626   Exosomal proteins of bladder cancer cells    141517626 GTP-binding proteins [BR:mlao04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     141517626 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA MCR_beta AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  141517626 NCBI-ProteinID:  XP_074084955 LinkDB All DBs Position 3:69008416..69009495 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGPFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAMVVYDITNEESFARTKNWVKELQR QAIPNIVIALAGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPIRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacgagacctaatgggccaaataccgggaataaaatttgccag ttcaaactagtacttcttggcgaatctgctgtcggaaaatcaagtcttgtgcttcgattt gtgaagggtccatttcatgaatttcaagagagtaccatcggagctgcttttctaacccag actgtatgtctggatgatacaacagtaaaatttgaaatatgggatacagctggacaagaa aggtatcatagcttagcaccaatgtactacagaggcgcccaagcagcaatggttgtgtat gatatcacaaatgaggaatcctttgcaagaacaaaaaactgggttaaagaacttcagagg caagcaattcctaacattgtaatagctttagcagggaacaaggctgatctagccaataaa agagctgtagatttccaggaagcacagtcttatgcagatgacaacagtttattattcatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagccaaaaag ttgccgaagaatgaaccacagaatccaggagccaattctgccagaggaagaggtgtagac cttaccgaacccacacaaccaattaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system