KEGG   Macrotis lagotis (bilby): 141522752
Entry
141522752         CDS       T11097                                 
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1-like
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
mlao  Macrotis lagotis (bilby)
Pathway
mlao01521  EGFR tyrosine kinase inhibitor resistance
mlao01522  Endocrine resistance
mlao04010  MAPK signaling pathway
mlao04012  ErbB signaling pathway
mlao04014  Ras signaling pathway
mlao04015  Rap1 signaling pathway
mlao04022  cGMP-PKG signaling pathway
mlao04024  cAMP signaling pathway
mlao04062  Chemokine signaling pathway
mlao04066  HIF-1 signaling pathway
mlao04068  FoxO signaling pathway
mlao04071  Sphingolipid signaling pathway
mlao04072  Phospholipase D signaling pathway
mlao04114  Oocyte meiosis
mlao04140  Autophagy - animal
mlao04148  Efferocytosis
mlao04150  mTOR signaling pathway
mlao04151  PI3K-Akt signaling pathway
mlao04210  Apoptosis
mlao04218  Cellular senescence
mlao04270  Vascular smooth muscle contraction
mlao04370  VEGF signaling pathway
mlao04371  Apelin signaling pathway
mlao04380  Osteoclast differentiation
mlao04510  Focal adhesion
mlao04540  Gap junction
mlao04550  Signaling pathways regulating pluripotency of stem cells
mlao04613  Neutrophil extracellular trap formation
mlao04620  Toll-like receptor signaling pathway
mlao04650  Natural killer cell mediated cytotoxicity
mlao04660  T cell receptor signaling pathway
mlao04662  B cell receptor signaling pathway
mlao04664  Fc epsilon RI signaling pathway
mlao04666  Fc gamma R-mediated phagocytosis
mlao04668  TNF signaling pathway
mlao04720  Long-term potentiation
mlao04722  Neurotrophin signaling pathway
mlao04725  Cholinergic synapse
mlao04726  Serotonergic synapse
mlao04730  Long-term depression
mlao04810  Regulation of actin cytoskeleton
mlao04910  Insulin signaling pathway
mlao04912  GnRH signaling pathway
mlao04914  Progesterone-mediated oocyte maturation
mlao04915  Estrogen signaling pathway
mlao04916  Melanogenesis
mlao04917  Prolactin signaling pathway
mlao04919  Thyroid hormone signaling pathway
mlao04921  Oxytocin signaling pathway
mlao04926  Relaxin signaling pathway
mlao04928  Parathyroid hormone synthesis, secretion and action
mlao04929  GnRH secretion
mlao04934  Cushing syndrome
mlao04935  Growth hormone synthesis, secretion and action
mlao05010  Alzheimer disease
mlao05022  Pathways of neurodegeneration - multiple diseases
mlao05034  Alcoholism
mlao05132  Salmonella infection
mlao05135  Yersinia infection
mlao05160  Hepatitis C
mlao05161  Hepatitis B
mlao05163  Human cytomegalovirus infection
mlao05164  Influenza A
mlao05165  Human papillomavirus infection
mlao05166  Human T-cell leukemia virus 1 infection
mlao05167  Kaposi sarcoma-associated herpesvirus infection
mlao05170  Human immunodeficiency virus 1 infection
mlao05200  Pathways in cancer
mlao05205  Proteoglycans in cancer
mlao05206  MicroRNAs in cancer
mlao05207  Chemical carcinogenesis - receptor activation
mlao05208  Chemical carcinogenesis - reactive oxygen species
mlao05210  Colorectal cancer
mlao05211  Renal cell carcinoma
mlao05212  Pancreatic cancer
mlao05213  Endometrial cancer
mlao05214  Glioma
mlao05215  Prostate cancer
mlao05216  Thyroid cancer
mlao05218  Melanoma
mlao05219  Bladder cancer
mlao05220  Chronic myeloid leukemia
mlao05221  Acute myeloid leukemia
mlao05223  Non-small cell lung cancer
mlao05224  Breast cancer
mlao05225  Hepatocellular carcinoma
mlao05226  Gastric cancer
mlao05230  Central carbon metabolism in cancer
mlao05231  Choline metabolism in cancer
mlao05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mlao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    141522752
   04012 ErbB signaling pathway
    141522752
   04014 Ras signaling pathway
    141522752
   04015 Rap1 signaling pathway
    141522752
   04370 VEGF signaling pathway
    141522752
   04371 Apelin signaling pathway
    141522752
   04668 TNF signaling pathway
    141522752
   04066 HIF-1 signaling pathway
    141522752
   04068 FoxO signaling pathway
    141522752
   04072 Phospholipase D signaling pathway
    141522752
   04071 Sphingolipid signaling pathway
    141522752
   04024 cAMP signaling pathway
    141522752
   04022 cGMP-PKG signaling pathway
    141522752
   04151 PI3K-Akt signaling pathway
    141522752
   04150 mTOR signaling pathway
    141522752
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    141522752
   04148 Efferocytosis
    141522752
  09143 Cell growth and death
   04114 Oocyte meiosis
    141522752
   04210 Apoptosis
    141522752
   04218 Cellular senescence
    141522752
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    141522752
   04540 Gap junction
    141522752
   04550 Signaling pathways regulating pluripotency of stem cells
    141522752
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    141522752
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    141522752
   04620 Toll-like receptor signaling pathway
    141522752
   04650 Natural killer cell mediated cytotoxicity
    141522752
   04660 T cell receptor signaling pathway
    141522752
   04662 B cell receptor signaling pathway
    141522752
   04664 Fc epsilon RI signaling pathway
    141522752
   04666 Fc gamma R-mediated phagocytosis
    141522752
   04062 Chemokine signaling pathway
    141522752
  09152 Endocrine system
   04910 Insulin signaling pathway
    141522752
   04929 GnRH secretion
    141522752
   04912 GnRH signaling pathway
    141522752
   04915 Estrogen signaling pathway
    141522752
   04914 Progesterone-mediated oocyte maturation
    141522752
   04917 Prolactin signaling pathway
    141522752
   04921 Oxytocin signaling pathway
    141522752
   04926 Relaxin signaling pathway
    141522752
   04935 Growth hormone synthesis, secretion and action
    141522752
   04919 Thyroid hormone signaling pathway
    141522752
   04928 Parathyroid hormone synthesis, secretion and action
    141522752
   04916 Melanogenesis
    141522752
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    141522752
  09156 Nervous system
   04725 Cholinergic synapse
    141522752
   04726 Serotonergic synapse
    141522752
   04720 Long-term potentiation
    141522752
   04730 Long-term depression
    141522752
   04722 Neurotrophin signaling pathway
    141522752
  09158 Development and regeneration
   04380 Osteoclast differentiation
    141522752
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    141522752
   05206 MicroRNAs in cancer
    141522752
   05205 Proteoglycans in cancer
    141522752
   05207 Chemical carcinogenesis - receptor activation
    141522752
   05208 Chemical carcinogenesis - reactive oxygen species
    141522752
   05230 Central carbon metabolism in cancer
    141522752
   05231 Choline metabolism in cancer
    141522752
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    141522752
  09162 Cancer: specific types
   05210 Colorectal cancer
    141522752
   05212 Pancreatic cancer
    141522752
   05225 Hepatocellular carcinoma
    141522752
   05226 Gastric cancer
    141522752
   05214 Glioma
    141522752
   05216 Thyroid cancer
    141522752
   05221 Acute myeloid leukemia
    141522752
   05220 Chronic myeloid leukemia
    141522752
   05218 Melanoma
    141522752
   05211 Renal cell carcinoma
    141522752
   05219 Bladder cancer
    141522752
   05215 Prostate cancer
    141522752
   05213 Endometrial cancer
    141522752
   05224 Breast cancer
    141522752
   05223 Non-small cell lung cancer
    141522752
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    141522752
   05170 Human immunodeficiency virus 1 infection
    141522752
   05161 Hepatitis B
    141522752
   05160 Hepatitis C
    141522752
   05164 Influenza A
    141522752
   05163 Human cytomegalovirus infection
    141522752
   05167 Kaposi sarcoma-associated herpesvirus infection
    141522752
   05165 Human papillomavirus infection
    141522752
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    141522752
   05135 Yersinia infection
    141522752
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    141522752
   05022 Pathways of neurodegeneration - multiple diseases
    141522752
  09165 Substance dependence
   05034 Alcoholism
    141522752
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    141522752
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    141522752
   01522 Endocrine resistance
    141522752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlao01001]
    141522752
Enzymes [BR:mlao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     141522752
Protein kinases [BR:mlao01001]
 Serine/threonine kinases: STE group
  STE7 family
   141522752
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Haspin_kinase Seadorna_VP7 MAM1
Other DBs
NCBI-GeneID: 141522752
NCBI-ProteinID: XP_074092322
LinkDB
Position
4:154715162..154778160
AA seq 322 aa
MEAAPLDCPESEDNYHVHLPHCLTRTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGE
LKDDDFEKISELGAGNGGVVFKVSHKPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECN
SPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLRE
KHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSV
QSDIWSMGLSLVEMAIGRYPIPPPDSKELELMFGCPMEGDAPETSPRPRTPGRPLSSYGM
DSRPPMAIFELLDYIVNEVNTV
NT seq 969 nt   +upstreamnt  +downstreamnt
atggaagcagctcctcttgactgtccagagagcgaggacaactatcatgtccacctacct
cactgcctgaccaggactaaccttgaggcgctgcagaagaagctggaggaattagaactt
gatgaacagcagcgcaagcgtctggaggcttttctcactcagaaacagaaagtcggtgag
ctcaaggatgatgactttgagaagatcagtgaactgggagccggaaatggtggtgtggtg
tttaaagtttcgcacaaaccatctggcctgatcatggcaagaaagctgattcacctggag
atcaaaccagcaatacggaaccagattatacgagagctgcaagtcctgcatgaatgcaac
tctccatatattgtagggttttatggggccttttacagcgatggggaaatcagtatctgc
atggagcacatggatgggggatctttggaccaggttcttaagaaggctggaagaattcct
gagcagatcttggggaaagttagcattgctgtaataaagggtcttacatatctgagggag
aagcacaagataatgcatagagatgtcaaaccatcgaacatcttggtgaactcacgaggg
gaaatcaagctttgtgactttggagtcagtgggcaactgattgattccatggctaactcc
ttcgtgggaacaaggtcttatatgtcgccagaaagactccaggggactcactactcagta
caatcagatatctggagcatgggactttctttggtggagatggcaattggacgatatccc
attccacctccagactccaaagagctagaactgatgtttggctgtccaatggagggagat
gctcctgagacatcaccaagaccaagaactcctgggagacctctcagctcttatggaatg
gatagccggccacctatggcaatttttgagctgctggattatatagtcaatgaggtaaat
acagtatga

DBGET integrated database retrieval system