KEGG   Methylomicrobium lacus: ACEPPP_18615
Entry
ACEPPP_18615      CDS       T10917                                 
Symbol
lptF
Name
(GenBank) LPS export ABC transporter permease LptF
  KO
K07091  lipopolysaccharide export system permease protein
Organism
mlau  Methylomicrobium lacus
Pathway
mlau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mlau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ACEPPP_18615 (lptF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mlau02000]
    ACEPPP_18615 (lptF)
Transporters [BR:mlau02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    ACEPPP_18615 (lptF)
SSDB
Motif
Pfam: LptF_LptG FtsX
Other DBs
NCBI-ProteinID: XGK39502
LinkDB
Position
complement(4147958..4149118)
AA seq 386 aa
MIEETRLEANWPQGSYSARRPLFGVLDRMIAADLLKTMLSVWSVIVVIIVSRKFIKVLDQ
AIDGQISNDALLKILGLKTIVAGVAFLPAATFMAVLMVLGRMYRDQEMSAIQSAGAGAGA
IYRSVFQFVLPLSLIAAGLSFYAAPWAEATTEQLVSKDKQSADIRGIAPGKFSEYSGGDL
VFYVEDIGKDKKMHKVFVQHRQKHGGALAIVNAESGRLEDLPDGRYMILEQGERIQGQPG
DLNYVIEEFAEYAVRIEGKEALAREVPEAASSSLLWLSDKLPDIAELQRRLGIPLGALLL
SFIAVPLAQLSPRGGVYGNILTGFLIFFIYGNLERVSQGWVTKAVIPPWLGPTSVYGLLV
LISLVYLARYFGWKWLRLKLKEATSQ
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgattgaggagacgcgcttggaggcaaattggccgcaaggcagttattcagcacgccgg
ccgctgtttggcgtgctggacaggatgatcgcggcagacctgctcaaaacgatgctgtcg
gtctggtcggtgatcgtggtgatcatcgtcagccgcaaattcatcaaggtgctcgaccag
gcgatcgacggacagatttcgaatgacgccctgctcaagatcctcggcctcaagacgatc
gtcgccggcgtggcgtttttaccggccgccaccttcatggcggtgttgatggtgctgggc
cgcatgtaccgcgaccaggaaatgtcggcgatccagtccgccggagccggcgcgggcgcg
atttaccgctcggtctttcaattcgtgttgccgctgagcctgatcgcggccggcctgtcg
ttttatgccgcgccctgggccgaagccaccacggaacagttggtcagcaaggacaaacaa
agcgccgacatccgcggcatcgcgcccggcaaattcagcgaatacagcggcggcgacctg
gtgttttatgtcgaggacatcggcaaggacaaaaaaatgcacaaggtctttgtgcagcac
cggcagaagcacggcggcgccctggccatcgtgaacgccgaatccggccgcctggaagat
ttgcccgacggccgctacatgatattggaacagggcgagcgtatccaaggccagcccggc
gacctgaactatgtgatcgaagaattcgccgaatatgcggtcaggatcgagggcaaggaa
gccctcgcgcgcgaggtgccggaagccgcgtccagctccctcttgtggttatcggacaaa
ctgcccgacatcgccgaactgcaaaggcgcctggggattccgctcggcgccctgctgctc
agcttcatcgccgtaccgctggcgcagctatcccctcgcggcggcgtttacggcaatatc
ctgaccggttttctgatcttttttatttacggcaacctcgaacgcgtcagccagggctgg
gtcaccaaggcggtcattccgccctggctcggtccgaccagcgtgtatggtttgctggta
ttgataagcctggtctatctggctcggtatttcggctggaagtggctgcgtctcaagtta
aaggaagcgacatctcaatga

DBGET integrated database retrieval system