Mycobacterium leprae Br4923: MLBr01331 Help Entry MLBr01331         CDS       T00842                                  Name (GenBank) possible secreted protein   KO K03116   sec-independent protein translocase protein TatA Organism mlb  Mycobacterium leprae Br4923 Pathway mlb03060   Protein export mlb03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mlb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MLBr01331  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MLBr01331  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mlb02044]     MLBr01331 Secretion system [BR:mlb02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    MLBr01331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  CAR71426 UniProt:  A0A0H3MQS2 LinkDB All DBs Position 1583207..1583494 Genome browser AA seq 95 aa AA seqDB search MSGGKFKVGSLSPWHWVVLVVVVVLLFGAKKLPDAARSLGKSMRIFKSELREMQTENQAQ ASALETPMQNPTVVQSQRVVPPWSTEQDHTEARPA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtctggaggtaaatttaaagtgggtagtcttagtccatggcactgggtggtcctcgtt gtcgtagtggtcctgctgttcggtgccaagaagctccccgatgctgcgcgctcgttgggt aagtcgatgcgcatttttaagtctgaactacgtgaaatgcagaccgagaaccaggcgcaa gcgtctgcccttgagacaccaatgcagaaccccacggttgtgcagtcccagcgggtcgtc ccgccatggtcgactgagcaggatcacaccgaggcgcggccggcttag

DBGET integrated database retrieval system