Microvirga lotononidis: U0023_00315 Help Entry U0023_00315       CDS       T09656                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mld  Microvirga lotononidis Pathway mld01100   Metabolic pathways mld01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mld00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     U0023_00315    00074 Mycolic acid biosynthesis     U0023_00315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     U0023_00315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  WQO27592 LinkDB All DBs Position complement(75360..75596) Genome browser AA seq 78 aa AA seqDB search MSDVADRVKKIVVEHLGVEADKVTDNANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIVTVGDAIRFLEKNAA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgacgtcgctgatcgcgtgaagaagattgttgtcgagcacctcggcgtcgaagcc gacaaggtgaccgacaacgccaacttcatcgacgacctgggcgccgacagcctggatacg gtcgagctggtgatggcgttcgaggaagagttcaacgtcgagatcccggacgacgcggct gagaccatcgtgacggtcggcgacgccatccgcttcctcgagaagaacgcagcctaa

DBGET integrated database retrieval system