Microvirga lotononidis: U0023_14720 Help Entry U0023_14720       CDS       T09656                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mld  Microvirga lotononidis Pathway mld00190   Oxidative phosphorylation mld01100   Metabolic pathways Module mld_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mld00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     U0023_14720  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mld00194]     U0023_14720 Photosynthesis proteins [BR:mld00194]  Photosystem and electron transport system   F-type ATPase [OT]    U0023_14720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C MFS_3 Motif Other DBs NCBI-ProteinID:  WQO25960 LinkDB All DBs Position complement(3099373..3099597) Genome browser AA seq 74 aa AA seqDB search MDPVAFKFLGAGLACIGMGLAAMGVGNIFGNFLSGALRNPSAADGQFARAFIGAALAEGL GIFCLVVALVLLFT NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggatccggttgctttcaagttcctcggcgcgggcctcgcctgcatcggcatgggtctc gccgctatgggcgttggcaacatcttcggtaacttcctctccggcgccctgcgcaacccg tcggctgccgacggtcagttcgcccgcgcgttcatcggtgcggcgctcgcagaaggtctc ggcatcttctgtctcgtcgtcgctctcgttctgctcttcacctaa

DBGET integrated database retrieval system