Microvirga lotononidis: U0023_31190 Help Entry U0023_31190       CDS       T09656                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mld  Microvirga lotononidis Pathway mld02024   Quorum sensing mld03018   RNA degradation Brite KEGG Orthology (KO) [BR:mld00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     U0023_31190 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     U0023_31190 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mld03019]     U0023_31190 (hfq)    03036 Chromosome and associated proteins [BR:mld03036]     U0023_31190 (hfq) Messenger RNA biogenesis [BR:mld03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      U0023_31190 (hfq) Chromosome and associated proteins [BR:mld03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     U0023_31190 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Motif Other DBs NCBI-ProteinID:  WQO31817 LinkDB All DBs Position unnamed2:316300..316584 Genome browser AA seq 94 aa AA seqDB search MTAKSTSPLQDTLLQHLRDGNIEVTMFLVNGIRLLGWIKRFDSFTVQLVRGSSSQVVYKH AISTILPAEPIPLFVPEAESDDDRSHPDLEHKVQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgaccgcaaaaagcacctcacccctgcaggatacgctcctccagcacctgcgcgacggc aacatcgaggtgacgatgttcctcgtgaacgggatcaggcttctgggctggatcaaacgg tttgacagcttcacggttcagcttgtgcgaggcagcagctcgcaggtcgtctacaagcat gccatttcgaccattctcccggcagagccgatccccctgtttgttccggaagccgagagt gacgatgatcggtcacacccggatctggaacacaaggtacaataa

DBGET integrated database retrieval system