Mycobacterium leprae TN: ML1331 Help Entry ML1331            CDS       T00047                                  Name (GenBank) possible secreted protein   KO K03116   sec-independent protein translocase protein TatA Organism mle  Mycobacterium leprae TN Pathway mle03060   Protein export mle03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mle00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     ML1331  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     ML1331  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mle02044]     ML1331 Secretion system [BR:mle02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    ML1331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  CAC31712 Pasteur:  ML1331 UniProt:  P54079 LinkDB All DBs Position 1583184..1583471 Genome browser AA seq 95 aa AA seqDB search MSGGKFKVGSLSPWHWVVLVVVVVLLFGAKKLPDAARSLGKSMRIFKSELREMQTENQAQ ASALETPMQNPTVVQSQRVVPPWSTEQDHTEARPA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtctggaggtaaatttaaagtgggtagtcttagtccatggcactgggtggtcctcgtt gtcgtagtggtcctgctgttcggtgccaagaagctccccgatgctgcgcgctcgttgggt aagtcgatgcgcatttttaagtctgaactacgtgaaatgcagaccgagaaccaggcgcaa gcgtctgcccttgagacaccaatgcagaaccccacggttgtgcagtcccagcgggtcgtc ccgccatggtcgactgagcaggatcacaccgaggcgcggccggcttag

DBGET integrated database retrieval system