Mammaliicoccus lentus: H3V22_00585 Help Entry H3V22_00585       CDS       T07021                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mlen  Mammaliicoccus lentus Pathway mlen01100   Metabolic pathways mlen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mlen00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3V22_00585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3V22_00585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QMU10762 LinkDB All DBs Position 121447..121680 Genome browser AA seq 77 aa AA seqDB search MASFDKVKDIIVDRLGVDAEKVTPEASFKDDLGADSLDIAELVMELEDEFDMEIPDEEAE KINTVGDAVKYIESLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaagtttcgataaagtaaaagacattattgtagatcgtctaggagtagacgctgaa aaagtaacacctgaagcttcatttaaagatgatttaggtgctgattctctagatattgct gaattagtaatggaattagaagatgaatttgatatggaaatccctgatgaggaagcagaa aaaatcaacacagttggtgacgctgttaaatatattgaatcattagagaaataa

DBGET integrated database retrieval system