Mandrillus leucophaeus (drill): 105528978 Help Entry 105528978         CDS       T08763                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04010   MAPK signaling pathway mleu04014   Ras signaling pathway mleu04015   Rap1 signaling pathway mleu04024   cAMP signaling pathway mleu04072   Phospholipase D signaling pathway mleu04137   Mitophagy - animal mleu04140   Autophagy - animal mleu04218   Cellular senescence mleu04360   Axon guidance mleu04371   Apelin signaling pathway mleu04625   C-type lectin receptor signaling pathway mleu04810   Regulation of actin cytoskeleton mleu05132   Salmonella infection mleu05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105528978 (RRAS)    04014 Ras signaling pathway     105528978 (RRAS)    04015 Rap1 signaling pathway     105528978 (RRAS)    04371 Apelin signaling pathway     105528978 (RRAS)    04072 Phospholipase D signaling pathway     105528978 (RRAS)    04024 cAMP signaling pathway     105528978 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105528978 (RRAS)    04137 Mitophagy - animal     105528978 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     105528978 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105528978 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105528978 (RRAS)   09158 Development and regeneration    04360 Axon guidance     105528978 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     105528978 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     105528978 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mleu04031]     105528978 (RRAS) GTP-binding proteins [BR:mleu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105528978 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  105528978 NCBI-ProteinID:  XP_011821422 Ensembl:  ENSMLEG00000025479 UniProt:  A0A2K5XRI9 LinkDB All DBs Position Unknown AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLEAQRQVPRSEASAFGASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcgggggacctggg cccggggaccccccgcccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actattgaggactcctacacgaagatctgcagtgtggatgggatcccggcccggctggac atcctggacactgcgggccaggaggagttcggggccatgagagagcagtacatgcgtgcc ggccatggcttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagattctccgggtcaaggaccgcgatgacttccccgttgtgttggtc gggaacaaggcggatctggaggcacagcgccaggtcccccgatcagaagcatctgccttc ggcgcctcccaccacgtggcctactttgaggcctcggccaaactgcgtctcaacgtggac gaggcttttgagcagctggtgcgggctgtccggaaataccaggaacaagagctcccaccc agccctcccagtgcccccaggaagaagggcgggggctgcccctgcgtcctcctgtag

DBGET integrated database retrieval system