Mandrillus leucophaeus (drill): 105529300 Help Entry 105529300         CDS       T08763                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04621   NOD-like receptor signaling pathway mleu05012   Parkinson disease mleu05132   Salmonella infection mleu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105529300 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105529300 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     105529300 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105529300 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mleu03110]     105529300 (TXN) Chaperones and folding catalysts [BR:mleu03110]  Protein folding catalysts   Protein disulfide isomerase    105529300 (TXN) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 Thioredoxin_9 Glutaredoxin AhpC-TSA Redoxin DIM1 A6-like_Thioredoxin-like_C Motif Other DBs NCBI-GeneID:  105529300 NCBI-ProteinID:  XP_011821793 Ensembl:  ENSMLEG00000029435 UniProt:  A0A2K5Y4M6 LinkDB All DBs Position Unknown AA seq 83 aa AA seqDB search MVKQIESKAAFQEALNTAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQVGEFSGANKEKLEATINELV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaaggctgcttttcaggaagccttgaacaccgcaggtgat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtattccaacgtggtattccttgaagtagatgtggat gactgtcaggtgggtgaattttctggagccaataaggaaaagcttgaagccaccattaat gaattagtctaa

DBGET integrated database retrieval system