Mandrillus leucophaeus (drill): 105529323 Help Entry 105529323         CDS       T08763                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04613   Neutrophil extracellular trap formation mleu05034   Alcoholism mleu05203   Viral carcinogenesis mleu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105529323  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105529323   09163 Immune disease    05322 Systemic lupus erythematosus     105529323   09165 Substance dependence    05034 Alcoholism     105529323  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mleu03036]     105529323 Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105529323 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  105529323 NCBI-ProteinID:  XP_011821823 Ensembl:  ENSMLEG00000027285 UniProt:  A0A2K5XIB1 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagggcggaaaaggcttgggtaaagggggcgccaagcgtcaccgc aaagtcttgcgagataacatccagggtattaccaaacctgccatccggcgtcttgctcgg cgaggtggtgtcaagcgcatttctggactcatttatgaggagacccgcggggtgctgaag gtgtttctagagaacgtgatccgtgacgctgttacttacacggagcacgccaagcgcaag accgtaacagcgatggatgtggtctacgctctcaaacgacagggacgcactctttatggc ttcggcggctaa

DBGET integrated database retrieval system