KEGG   Mandrillus leucophaeus (drill): 105529636
Entry
105529636         CDS       T08763                                 
Symbol
TIGIT
Name
(RefSeq) T-cell immunoreceptor with Ig and ITIM domains isoform X1
  KO
K16350  T-cell immunoreceptor with Ig and ITIM domains
Organism
mleu  Mandrillus leucophaeus (drill)
Pathway
mleu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mleu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    105529636 (TIGIT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mleu04515]
    105529636 (TIGIT)
Cell adhesion molecules [BR:mleu04515]
 Immunoglobulin superfamily
  L1 family
   105529636 (TIGIT)
SSDB
Motif
Pfam: V-set ig Ig_3 Glucos_trans_II I-set Ig_2 HOK_GEF DUF5385
Other DBs
NCBI-GeneID: 105529636
NCBI-ProteinID: XP_011822212
Ensembl: ENSMLEG00000029251
UniProt: A0A2K5Y3J6
LinkDB
Position
Unknown
AA seq 245 aa
MWWCLFLIWAQGLRQAPLASGMMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWE
QHDHSLLAIRNADLGWHIFPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYT
GRIFLEVLESSVAEHSARFQIPLLGAMAMMLVVICIAVIVVVVLARKKKSLRIHSVESGL
RRKSTGQEEQIPSAPSPPGSCVQAEAAPAGLCGEQQGDDCAELHDYFNVLSYRSLGSCSF
FTETG
NT seq 738 nt   +upstreamnt  +downstreamnt
atgtggtggtgtctcttcctgatctgggcccaggggctgaggcaggctcccctcgcctca
ggaatgatgacaggcacaatagaaacaacggggaacatttctgcaaagaaaggtggctct
gttatcttacaatgtcacctctcctccaccatggcacaagtgacccaggtcaactgggag
cagcatgaccattcgcttctggccattcgtaatgctgacttggggtggcacatcttccca
gccttcaaggatcgagtggccccgggtcctggcctgggcctcaccctccagtcgctgacc
atgaatgatacaggggagtacttctgcacctatcacacctaccctgatgggacttacaca
gggagaatcttcctggaggtcctagaaagctcagtggctgagcacagtgccaggttccag
attccattgcttggagccatggccatgatgctggtggtcatctgcatagcagtcatcgtg
gtggtcgtgttggctagaaagaagaaatccctcagaatccattctgtggaaagtggcctc
cggagaaaatcaactggacaggaagaacagattcccagtgctccctcacccccaggaagc
tgtgtccaggcagaagctgcacctgctgggctctgtggagagcagcagggagatgactgt
gccgagctgcatgactacttcaatgtcctgagttacagaagcctggggagctgcagcttc
ttcacagagactggttag

DBGET integrated database retrieval system