Mandrillus leucophaeus (drill): 105530862 Help Entry 105530862         CDS       T08763                                  Symbol CCL8 Name (RefSeq) C-C motif chemokine 8   KO K16596   C-C motif chemokine 8 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105530862 (CCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     105530862 (CCL8)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     105530862 (CCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105530862 (CCL8) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105530862 (CCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 GPR15L CXCL16 Motif Other DBs NCBI-GeneID:  105530862 NCBI-ProteinID:  XP_011823981 Ensembl:  ENSMLEG00000041698 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MLKLTPLPSNMKVSAALLCLLLMAATFSPQGLAQPDSVSIPITCCFNVINRKIPIQRLQS YTRITNIQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgctgaagctcacacccttgccctccaacatgaaggtttctgcagcacttctgtgcctg ctgctcatggcagccactttcagcccacagggacttgctcagccagattcagtttccatt ccaatcacctgctgctttaatgtgatcaataggaaaattcctatccagaggctgcagagc tacacaagaatcaccaacatccagtgtcccaaggaagctgtgatcttcaagaccaaatgg ggcaaggaagtctgtgctgaccccaaggagagatgggtcagggattccatgaagcatctg gaccaaatgtttcaaaatctgaagccttga

DBGET integrated database retrieval system