Mandrillus leucophaeus (drill): 105530863 Help Entry 105530863         CDS       T08763                                  Symbol CCL11 Name (RefSeq) eotaxin   KO K16597   C-C motif chemokine 11 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway mleu04657   IL-17 signaling pathway mleu05310   Asthma Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105530863 (CCL11)    04061 Viral protein interaction with cytokine and cytokine receptor     105530863 (CCL11)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     105530863 (CCL11)    04062 Chemokine signaling pathway     105530863 (CCL11)  09160 Human Diseases   09163 Immune disease    05310 Asthma     105530863 (CCL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105530863 (CCL11) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105530863 (CCL11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105530863 NCBI-ProteinID:  XP_011823982 Ensembl:  ENSMLEG00000033600 UniProt:  A0A2K5YTA3 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MKVSATLLWLLLVAAAFSPQGLTGPASVATTCCFTLTNKKIPLQRLESYRRIISGKCPQK AVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKL NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcaacacttctgtggctgctgctcgtagcagctgcgttcagcccccag gggctcactgggccagcttctgttgcaaccacctgctgctttaccctgaccaataagaag ataccccttcagcgactggagagctacagaaggatcatcagtggcaaatgtccccagaaa gctgtgatcttcaagaccaaactggccaaggatatctgtgccgaccccaagaagaagtgg gtgcaggattccatgaagtatctggaccgaaaatctccaactccaaagctgtaa

DBGET integrated database retrieval system