Mandrillus leucophaeus (drill): 105531127 Help Entry 105531127         CDS       T08763                                  Symbol CXCL5 Name (RefSeq) C-X-C motif chemokine 5   KO K05506   C-X-C motif chemokine 5/6 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway mleu04657   IL-17 signaling pathway mleu04668   TNF signaling pathway mleu05133   Pertussis mleu05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     105531127 (CXCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105531127 (CXCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     105531127 (CXCL5)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     105531127 (CXCL5)    04062 Chemokine signaling pathway     105531127 (CXCL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     105531127 (CXCL5)   09163 Immune disease    05323 Rheumatoid arthritis     105531127 (CXCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105531127 (CXCL5) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105531127 (CXCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105531127 NCBI-ProteinID:  XP_011824347 Ensembl:  ENSMLEG00000041463 UniProt:  A0A2K6A3H8 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MSLLSSRPARVPGPLGSLCALLALLLLLPPPGPLSPAGPVAAALRELRCSCLQTTQGVQP QMISNLQVFAIGPQCSEVEVVASLKNGTEVCLDPQARFLKKVIQKILDGENKDN NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcctcctgtccagtcgcccggcccgtgtcccgggtcctttgggctccttgtgcgcc ctgctcgcgctgctgctgctgctgccgccgccagggcccctcagcccagctggtcctgtc gctgctgcgttgagagagctgcgttgcagttgtttacagaccacgcagggagttcaaccc caaatgatcagtaatctgcaggtgttcgccataggcccgcagtgctctgaggtggaagtg gtagcctccctgaagaacgggacggaagtttgtctcgatccacaagcccgttttctaaag aaagtcatccagaaaattttggacggtgaaaacaaggacaactga

DBGET integrated database retrieval system