Mandrillus leucophaeus (drill): 105531128 Help Entry 105531128         CDS       T08763                                  Symbol PPBP Name (RefSeq) platelet basic protein   KO K10029   platelet basic protein Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105531128 (PPBP)    04061 Viral protein interaction with cytokine and cytokine receptor     105531128 (PPBP)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     105531128 (PPBP)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105531128 (PPBP) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105531128 (PPBP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105531128 NCBI-ProteinID:  XP_011824348 Ensembl:  ENSMLEG00000034227 UniProt:  A0A2K5YWS5 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKSKEESLDSELYAE LRCLCMKTTSGIHPKNIQSLEVIGKGIHCNQVEVIATLKDGRKICLDPNAPRIKKIVQKK LAGDESAD NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcctcagacttgataccacgccttcctgtaacagtgccagaccacttcatgccctg caggtgctgctgcttctgtcactgctgctgactgctctggcttcctccaccaaaggacaa actaagagaaacttggcgaaaagcaaagaggaaagtctagacagtgagttgtacgctgaa ctgcgctgcttgtgtatgaagacaacctctggaattcatcccaaaaacatccaaagtttg gaagtgatcgggaaaggaatccattgcaaccaagtcgaagtgatagccacattgaaggat gggaggaaaatctgcctggacccaaatgctcccagaattaagaaaattgtacagaaaaaa ttggcaggtgatgaatccgctgattaa

DBGET integrated database retrieval system