Mandrillus leucophaeus (drill): 105531349 Help Entry 105531349         CDS       T08763                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04630   JAK-STAT signaling pathway mleu04640   Hematopoietic cell lineage mleu04657   IL-17 signaling pathway mleu04658   Th1 and Th2 cell differentiation mleu04660   T cell receptor signaling pathway mleu04664   Fc epsilon RI signaling pathway mleu04672   Intestinal immune network for IgA production mleu05200   Pathways in cancer mleu05310   Asthma mleu05320   Autoimmune thyroid disease mleu05321   Inflammatory bowel disease mleu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105531349 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105531349 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105531349 (IL5)    04660 T cell receptor signaling pathway     105531349 (IL5)    04658 Th1 and Th2 cell differentiation     105531349 (IL5)    04657 IL-17 signaling pathway     105531349 (IL5)    04664 Fc epsilon RI signaling pathway     105531349 (IL5)    04672 Intestinal immune network for IgA production     105531349 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105531349 (IL5)   09163 Immune disease    05310 Asthma     105531349 (IL5)    05320 Autoimmune thyroid disease     105531349 (IL5)    05321 Inflammatory bowel disease     105531349 (IL5)    05330 Allograft rejection     105531349 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105531349 (IL5)    00536 Glycosaminoglycan binding proteins [BR:mleu00536]     105531349 (IL5) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Interleukins    105531349 (IL5) Glycosaminoglycan binding proteins [BR:mleu00536]  Heparan sulfate / Heparin   Cytokines    105531349 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 DUF6034 Motif Other DBs NCBI-GeneID:  105531349 NCBI-ProteinID:  XP_011824661 Ensembl:  ENSMLEG00000029971 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MLLHLSLLALGAAYMYAIPTEIPTSALVKETLALLSTHRTLLIGNETLRIPVPVHKHHQL CTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEF LGVMNTEWIIES NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgcttctacatttgagtttgctagctcttggagctgcttacatgtatgccatccccaca gaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcatcgaact ctgctgataggcaatgagactctgaggattcctgttcctgtacataaacatcaccaactg tgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaagggggt actgtggaaagactattcaaaaacttgtctttaataaagaaatacattgacggccaaaaa aagaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaagagttt cttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system