Mandrillus leucophaeus (drill): 105531569 Help Entry 105531569         CDS       T08763                                  Symbol CALM3 Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04014   Ras signaling pathway mleu04015   Rap1 signaling pathway mleu04020   Calcium signaling pathway mleu04022   cGMP-PKG signaling pathway mleu04024   cAMP signaling pathway mleu04070   Phosphatidylinositol signaling system mleu04114   Oocyte meiosis mleu04218   Cellular senescence mleu04261   Adrenergic signaling in cardiomyocytes mleu04270   Vascular smooth muscle contraction mleu04371   Apelin signaling pathway mleu04625   C-type lectin receptor signaling pathway mleu04713   Circadian entrainment mleu04720   Long-term potentiation mleu04722   Neurotrophin signaling pathway mleu04728   Dopaminergic synapse mleu04740   Olfactory transduction mleu04744   Phototransduction mleu04750   Inflammatory mediator regulation of TRP channels mleu04910   Insulin signaling pathway mleu04912   GnRH signaling pathway mleu04915   Estrogen signaling pathway mleu04916   Melanogenesis mleu04921   Oxytocin signaling pathway mleu04922   Glucagon signaling pathway mleu04924   Renin secretion mleu04925   Aldosterone synthesis and secretion mleu04970   Salivary secretion mleu04971   Gastric acid secretion mleu05010   Alzheimer disease mleu05012   Parkinson disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05031   Amphetamine addiction mleu05034   Alcoholism mleu05133   Pertussis mleu05152   Tuberculosis mleu05163   Human cytomegalovirus infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05170   Human immunodeficiency virus 1 infection mleu05200   Pathways in cancer mleu05214   Glioma mleu05417   Lipid and atherosclerosis mleu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105531569 (CALM3)    04015 Rap1 signaling pathway     105531569 (CALM3)    04371 Apelin signaling pathway     105531569 (CALM3)    04020 Calcium signaling pathway     105531569 (CALM3)    04070 Phosphatidylinositol signaling system     105531569 (CALM3)    04024 cAMP signaling pathway     105531569 (CALM3)    04022 cGMP-PKG signaling pathway     105531569 (CALM3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105531569 (CALM3)    04218 Cellular senescence     105531569 (CALM3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105531569 (CALM3)   09152 Endocrine system    04910 Insulin signaling pathway     105531569 (CALM3)    04922 Glucagon signaling pathway     105531569 (CALM3)    04912 GnRH signaling pathway     105531569 (CALM3)    04915 Estrogen signaling pathway     105531569 (CALM3)    04921 Oxytocin signaling pathway     105531569 (CALM3)    04916 Melanogenesis     105531569 (CALM3)    04924 Renin secretion     105531569 (CALM3)    04925 Aldosterone synthesis and secretion     105531569 (CALM3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     105531569 (CALM3)    04270 Vascular smooth muscle contraction     105531569 (CALM3)   09154 Digestive system    04970 Salivary secretion     105531569 (CALM3)    04971 Gastric acid secretion     105531569 (CALM3)   09156 Nervous system    04728 Dopaminergic synapse     105531569 (CALM3)    04720 Long-term potentiation     105531569 (CALM3)    04722 Neurotrophin signaling pathway     105531569 (CALM3)   09157 Sensory system    04744 Phototransduction     105531569 (CALM3)    04740 Olfactory transduction     105531569 (CALM3)    04750 Inflammatory mediator regulation of TRP channels     105531569 (CALM3)   09159 Environmental adaptation    04713 Circadian entrainment     105531569 (CALM3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105531569 (CALM3)   09162 Cancer: specific types    05214 Glioma     105531569 (CALM3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105531569 (CALM3)    05163 Human cytomegalovirus infection     105531569 (CALM3)    05167 Kaposi sarcoma-associated herpesvirus infection     105531569 (CALM3)   09171 Infectious disease: bacterial    05133 Pertussis     105531569 (CALM3)    05152 Tuberculosis     105531569 (CALM3)   09164 Neurodegenerative disease    05010 Alzheimer disease     105531569 (CALM3)    05012 Parkinson disease     105531569 (CALM3)    05022 Pathways of neurodegeneration - multiple diseases     105531569 (CALM3)   09165 Substance dependence    05031 Amphetamine addiction     105531569 (CALM3)    05034 Alcoholism     105531569 (CALM3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105531569 (CALM3)    05418 Fluid shear stress and atherosclerosis     105531569 (CALM3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mleu01009]     105531569 (CALM3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mleu04131]     105531569 (CALM3)    03036 Chromosome and associated proteins [BR:mleu03036]     105531569 (CALM3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105531569 (CALM3) Protein phosphatases and associated proteins [BR:mleu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105531569 (CALM3) Membrane trafficking [BR:mleu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     105531569 (CALM3) Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      105531569 (CALM3) Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105531569 (CALM3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF-hand_9 EH Dockerin_1 EF-hand_11 Motif Other DBs NCBI-GeneID:  105531569 NCBI-ProteinID:  XP_011824907 Ensembl:  ENSMLEG00000040728 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKV SNPPGAALRLTPAFRQTDRTGSTELPLPGGPRPGASLTANLLCHLRQPPSLCSLPRDGDD SHPSHCLSPRREKCPVKAFIPNPQDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI DGDGQVNYEEFVQMMTAK NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagatccctgggacagaaccccactgaagcagagctgcaggatatgatcaatgaggtg gatgcagatgggaacgggaccattgacttcccggagttcctgaccatgatggccagaaag atgaaggacacagacagtgaggaggagatccgagaggcgttccgtgtctttgacaaggta agcaaccctccaggggcagctctgagactgacaccagccttcaggcagacagacagaact ggatccacggagctaccacttccaggaggcccacgtcccggtgccagcctcactgccaac ctgctctgccacctcaggcagcctccctcactgtgctcactgccgagggatggtgatgac agccacccctctcactgcctctctccccgccgggagaagtgcccagtgaaagcctttatc cccaacccccaggatgggaacggctacatcagcgccgcagagctgcgtcacgtaatgacg aacctgggggagaagctgaccgatgaggaggtggatgagatgatcagagaggctgacatc gacggagatggccaggtcaattatgaagagtttgtacagatgatgactgcaaagtga

DBGET integrated database retrieval system