Mandrillus leucophaeus (drill): 105531859 Help Entry 105531859         CDS       T08763                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu03010   Ribosome mleu04120   Ubiquitin mediated proteolysis mleu04137   Mitophagy - animal mleu04140   Autophagy - animal mleu05012   Parkinson disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mleu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     105531859   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105531859  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105531859    04137 Mitophagy - animal     105531859  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     105531859    05167 Kaposi sarcoma-associated herpesvirus infection     105531859   09164 Neurodegenerative disease    05012 Parkinson disease     105531859    05022 Pathways of neurodegeneration - multiple diseases     105531859  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mleu03011]     105531859    04121 Ubiquitin system [BR:mleu04121]     105531859 Ribosome [BR:mleu03011]  Ribosomal proteins   Eukaryotes    Large subunit     105531859   Archaea     105531859 Ubiquitin system [BR:mleu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    105531859 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 DUF3104 Ubiquitin_5 DUF2604 TBK1_ULD Motif Other DBs NCBI-GeneID:  105531859 NCBI-ProteinID:  XP_011825253 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MQIFVKTLTGKTITLEVKPSDTNEDVKAKIQDKEGIPPDQQHLILAGKQLEDGRTLSDYD IWEESTLHLVLHLRGGIIEPSLRQLFQKHNFDKMICRKCYACLHPHAVNCCKKCDHTNNL HPKKKVKALPSSKGSLPGASIKCLFR NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagacacttacgggcaagaccatcactcttgaggtcaagcccagt gacaccaatgaggatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag cagcatctgatacttgccggcaaacagctggaggatggccgaactctctcagactacgac atctgggaagagtccaccctgcacctggtgctgcacctgcgaggtggcattattgagcct tccctccgccagctcttccagaaacacaactttgacaagatgatctgccgcaagtgctat gcttgcctgcacccccatgctgtcaactgctgcaagaagtgtgaccacaccaacaacctg caccccaagaagaaggtcaaggctcttccttcctcgaagggcagcctccctggagcctca ataaagtgtctctttcgttga

DBGET integrated database retrieval system