Mandrillus leucophaeus (drill): 105533396 Help Entry 105533396         CDS       T08763                                  Symbol CCL17 Name (RefSeq) C-C motif chemokine 17   KO K21083   C-C motif chemokine 17 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway mleu04625   C-type lectin receptor signaling pathway mleu04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105533396 (CCL17)    04061 Viral protein interaction with cytokine and cytokine receptor     105533396 (CCL17)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105533396 (CCL17)    04657 IL-17 signaling pathway     105533396 (CCL17)    04062 Chemokine signaling pathway     105533396 (CCL17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105533396 (CCL17) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105533396 (CCL17) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 JSRP Motif Other DBs NCBI-GeneID:  105533396 NCBI-ProteinID:  XP_011827238 Ensembl:  ENSMLEG00000040712 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MAPLKMLALVILLLGASLQHIHAARGTNVGRECCLKYFKGAIPLRKLKTWYQTPEDCSRD AIVFVTVQNKAICSDPNDKKVKKALKYLQSL NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggccccactgaagatgctggccctggtcatcctcctcctgggggcttctctgcagcac atccatgcagctcgagggaccaacgtgggccgggagtgctgcctgaagtacttcaaggga gccattccccttagaaagctgaagacgtggtaccagacacccgaggactgttccagggat gccattgtttttgtaactgtccagaacaaggccatctgttcggaccccaacgacaagaaa gtgaagaaggcacttaaatacctgcaaagcctctag

DBGET integrated database retrieval system