Mandrillus leucophaeus (drill): 105533398 Help Entry 105533398         CDS       T08763                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway mleu04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105533398 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     105533398 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105533398 (CCL22)    04062 Chemokine signaling pathway     105533398 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105533398 (CCL22) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105533398 (CCL22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  105533398 NCBI-ProteinID:  XP_011827242 Ensembl:  ENSMLEG00000043269 UniProt:  A0A2K6AED3 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MARLQTVFLGVLILLAVALQATEAGPYGANMEDSVCCRDYVRYRMPLRVVKHFYWTSDSC PRPGVVLLTSRDKEICADPRVPWVKMILNKLSQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctcgcctacagactgtgttcctgggtgtcctcatcctccttgctgtggcgcttcaa gcaactgaggcaggcccctacggcgccaacatggaagacagcgtctgctgccgtgattac gtccgttaccgtatgcccctgcgtgtggtgaaacacttctactggacctcagactcctgc ccgaggcctggcgtggtgttgctaacctccagggataaggagatctgtgccgatcccaga gtgccctgggtgaagatgattctcaataagctgagccaatga

DBGET integrated database retrieval system