Mandrillus leucophaeus (drill): 105533421 Help Entry 105533421         CDS       T08763                                  Name (RefSeq) metallothionein-1E-like   KO K14739   metallothionein 1/2 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105533421  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mleu03019]     105533421    03029 Mitochondrial biogenesis [BR:mleu03029]     105533421 Messenger RNA biogenesis [BR:mleu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105533421 Mitochondrial biogenesis [BR:mleu03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105533421 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105533421 NCBI-ProteinID:  XP_011827278 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPSCSCATGDSCTCASSCKCKEYKCTSCKKNCCSCCHVGCAKRAQGCVCKGASEKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccagctgctcctgcgccactggtgactcctgcacctgtgccagctcctgcaaa tgcaaagagtacaaatgcacctcctgcaagaagaactgttgctcctgctgccacgtgggc tgtgccaaacgtgcccagggctgtgtctgcaaaggggcatcggagaagtgcagctgctgc gcctga

DBGET integrated database retrieval system