Mandrillus leucophaeus (drill): 105533430 Help Entry 105533430         CDS       T08763                                  Name (RefSeq) metallothionein-1-like   KO K14739   metallothionein 1/2 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04978   Mineral absorption Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105533430  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mleu03019]     105533430    03029 Mitochondrial biogenesis [BR:mleu03029]     105533430 Messenger RNA biogenesis [BR:mleu03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105533430 Mitochondrial biogenesis [BR:mleu03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105533430 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105533430 NCBI-ProteinID:  XP_011827286 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCSTGGSCTCACSCKCKERTFTFCKKSCCSCCPVGCAKCAQGCVCKGTSDRCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgctccactggtgggtcctgcacctgtgcctgctcctgcaaa tgcaaagagcgcacattcaccttctgcaagaagagctgctgctcctgctgccccgtgggc tgtgctaagtgtgcccagggatgtgtctgtaaagggacatctgacaggtgcagctgctgc gcctga

DBGET integrated database retrieval system