Mandrillus leucophaeus (drill): 105535291 Help Entry 105535291         CDS       T08763                                  Symbol CALM1 Name (RefSeq) calmodulin isoform X1   KO K02183   calmodulin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04014   Ras signaling pathway mleu04015   Rap1 signaling pathway mleu04020   Calcium signaling pathway mleu04022   cGMP-PKG signaling pathway mleu04024   cAMP signaling pathway mleu04070   Phosphatidylinositol signaling system mleu04114   Oocyte meiosis mleu04218   Cellular senescence mleu04261   Adrenergic signaling in cardiomyocytes mleu04270   Vascular smooth muscle contraction mleu04371   Apelin signaling pathway mleu04625   C-type lectin receptor signaling pathway mleu04713   Circadian entrainment mleu04720   Long-term potentiation mleu04722   Neurotrophin signaling pathway mleu04728   Dopaminergic synapse mleu04740   Olfactory transduction mleu04744   Phototransduction mleu04750   Inflammatory mediator regulation of TRP channels mleu04910   Insulin signaling pathway mleu04912   GnRH signaling pathway mleu04915   Estrogen signaling pathway mleu04916   Melanogenesis mleu04921   Oxytocin signaling pathway mleu04922   Glucagon signaling pathway mleu04924   Renin secretion mleu04925   Aldosterone synthesis and secretion mleu04970   Salivary secretion mleu04971   Gastric acid secretion mleu05010   Alzheimer disease mleu05012   Parkinson disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05031   Amphetamine addiction mleu05034   Alcoholism mleu05133   Pertussis mleu05152   Tuberculosis mleu05163   Human cytomegalovirus infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05170   Human immunodeficiency virus 1 infection mleu05200   Pathways in cancer mleu05214   Glioma mleu05417   Lipid and atherosclerosis mleu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105535291 (CALM1)    04015 Rap1 signaling pathway     105535291 (CALM1)    04371 Apelin signaling pathway     105535291 (CALM1)    04020 Calcium signaling pathway     105535291 (CALM1)    04070 Phosphatidylinositol signaling system     105535291 (CALM1)    04024 cAMP signaling pathway     105535291 (CALM1)    04022 cGMP-PKG signaling pathway     105535291 (CALM1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105535291 (CALM1)    04218 Cellular senescence     105535291 (CALM1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105535291 (CALM1)   09152 Endocrine system    04910 Insulin signaling pathway     105535291 (CALM1)    04922 Glucagon signaling pathway     105535291 (CALM1)    04912 GnRH signaling pathway     105535291 (CALM1)    04915 Estrogen signaling pathway     105535291 (CALM1)    04921 Oxytocin signaling pathway     105535291 (CALM1)    04916 Melanogenesis     105535291 (CALM1)    04924 Renin secretion     105535291 (CALM1)    04925 Aldosterone synthesis and secretion     105535291 (CALM1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     105535291 (CALM1)    04270 Vascular smooth muscle contraction     105535291 (CALM1)   09154 Digestive system    04970 Salivary secretion     105535291 (CALM1)    04971 Gastric acid secretion     105535291 (CALM1)   09156 Nervous system    04728 Dopaminergic synapse     105535291 (CALM1)    04720 Long-term potentiation     105535291 (CALM1)    04722 Neurotrophin signaling pathway     105535291 (CALM1)   09157 Sensory system    04744 Phototransduction     105535291 (CALM1)    04740 Olfactory transduction     105535291 (CALM1)    04750 Inflammatory mediator regulation of TRP channels     105535291 (CALM1)   09159 Environmental adaptation    04713 Circadian entrainment     105535291 (CALM1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105535291 (CALM1)   09162 Cancer: specific types    05214 Glioma     105535291 (CALM1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105535291 (CALM1)    05163 Human cytomegalovirus infection     105535291 (CALM1)    05167 Kaposi sarcoma-associated herpesvirus infection     105535291 (CALM1)   09171 Infectious disease: bacterial    05133 Pertussis     105535291 (CALM1)    05152 Tuberculosis     105535291 (CALM1)   09164 Neurodegenerative disease    05010 Alzheimer disease     105535291 (CALM1)    05012 Parkinson disease     105535291 (CALM1)    05022 Pathways of neurodegeneration - multiple diseases     105535291 (CALM1)   09165 Substance dependence    05031 Amphetamine addiction     105535291 (CALM1)    05034 Alcoholism     105535291 (CALM1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105535291 (CALM1)    05418 Fluid shear stress and atherosclerosis     105535291 (CALM1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mleu01009]     105535291 (CALM1)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mleu04131]     105535291 (CALM1)    03036 Chromosome and associated proteins [BR:mleu03036]     105535291 (CALM1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105535291 (CALM1) Protein phosphatases and associated proteins [BR:mleu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105535291 (CALM1) Membrane trafficking [BR:mleu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     105535291 (CALM1) Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      105535291 (CALM1) Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    105535291 (CALM1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH UPF0154 SPARC_Ca_bdg EFhand_Ca_insen EF-hand_11 Dockerin_1 Caleosin FCaBP_EF-hand Poly_export DUF1103 SPEF2_C TerB PhageMin_Tail Fe_hyd_lg_C PA_Ig-like DUF5580_M Motif Other DBs NCBI-GeneID:  105535291 NCBI-ProteinID:  XP_011829706 Ensembl:  ENSMLEG00000029563 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEGKTKLFELSVS NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atggctgatcagctgaccgaggaacagattgctgaattcaaggaagctttctccctattc gataaggatggcgatggcaccatcacaacaaaggaacttggaactgtcatgaggtcactg ggtcagaacccaacagaagctgaattgcaggatatgatcaacgaagtggatgctgatggt aatggcaccattgacttccctgaatttttgactatgatggctagaaaaatgaaagataca gatagtgaagaagaaatccgtgaggcattccgagtctttgacaaggatggcaatggttac atcagtgcagcagaactacgtcacgtcatgacaaacttaggagaaaaactaacagatgaa gaagtagatgaaatgatcagagaagcagatattgatggagatggacaagtcaactatgaa ggtaaaacgaaattatttgagctcagtgtttcatag

DBGET integrated database retrieval system