Mandrillus leucophaeus (drill): 105537891 Help Entry 105537891         CDS       T08763                                  Symbol IFNA6 Name (RefSeq) interferon alpha-6   KO K05414   interferon alpha Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04151   PI3K-Akt signaling pathway mleu04217   Necroptosis mleu04620   Toll-like receptor signaling pathway mleu04621   NOD-like receptor signaling pathway mleu04622   RIG-I-like receptor signaling pathway mleu04623   Cytosolic DNA-sensing pathway mleu04630   JAK-STAT signaling pathway mleu04650   Natural killer cell mediated cytotoxicity mleu04936   Alcoholic liver disease mleu05152   Tuberculosis mleu05160   Hepatitis C mleu05161   Hepatitis B mleu05162   Measles mleu05163   Human cytomegalovirus infection mleu05164   Influenza A mleu05165   Human papillomavirus infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05168   Herpes simplex virus 1 infection mleu05169   Epstein-Barr virus infection mleu05170   Human immunodeficiency virus 1 infection mleu05171   Coronavirus disease - COVID-19 mleu05200   Pathways in cancer mleu05320   Autoimmune thyroid disease mleu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105537891 (IFNA6)    04151 PI3K-Akt signaling pathway     105537891 (IFNA6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105537891 (IFNA6)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105537891 (IFNA6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105537891 (IFNA6)    04621 NOD-like receptor signaling pathway     105537891 (IFNA6)    04622 RIG-I-like receptor signaling pathway     105537891 (IFNA6)    04623 Cytosolic DNA-sensing pathway     105537891 (IFNA6)    04650 Natural killer cell mediated cytotoxicity     105537891 (IFNA6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105537891 (IFNA6)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105537891 (IFNA6)    05161 Hepatitis B     105537891 (IFNA6)    05160 Hepatitis C     105537891 (IFNA6)    05171 Coronavirus disease - COVID-19     105537891 (IFNA6)    05164 Influenza A     105537891 (IFNA6)    05162 Measles     105537891 (IFNA6)    05168 Herpes simplex virus 1 infection     105537891 (IFNA6)    05163 Human cytomegalovirus infection     105537891 (IFNA6)    05167 Kaposi sarcoma-associated herpesvirus infection     105537891 (IFNA6)    05169 Epstein-Barr virus infection     105537891 (IFNA6)    05165 Human papillomavirus infection     105537891 (IFNA6)   09171 Infectious disease: bacterial    05152 Tuberculosis     105537891 (IFNA6)   09163 Immune disease    05320 Autoimmune thyroid disease     105537891 (IFNA6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105537891 (IFNA6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105537891 (IFNA6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105537891 (IFNA6) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Interferons    105537891 (IFNA6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon iSTAND CoV_NSP2_N Motif Other DBs NCBI-GeneID:  105537891 NCBI-ProteinID:  XP_011832977 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MALPFALLMALVVLSCKSSCSLGCDLPQTHSLGHRRTMMLLVQMRRISLFSCLKDRYDFR FPQEEFDGNQFQKAQAISVLHEVIQQTYNLFSTKDASAAWDERLLDKLYTELYQQLNDLE ACVMQEAWVGETPLMNEDSILAMRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc tctctgggctgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc ctggtacaaatgagaagaatctctcttttctcctgtctgaaggacagatacgacttcaga tttccccaggaggagtttgatggcaaccagttccagaaggctcaagctatctctgtcctc catgaggtgatccagcagacctacaacctcttcagcacaaaggacgcatctgctgcttgg gatgaaaggcttctagacaaactctacactgaactttaccagcagctgaatgacttggaa gcctgtgtgatgcaggaggcatgggtgggagagactcccctgatgaatgaggactccatc ctggctatgagaaaatacttccaaagaatcactctctacctgacagagaagaagtatagc ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac ttgcaagaaagattaaggaggaaggaataa

DBGET integrated database retrieval system