Mandrillus leucophaeus (drill): 105543183 Help Entry 105543183         CDS       T08763                                  Name (RefSeq) histone H3.3 type 2-like   KO K11253   histone H3 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04613   Neutrophil extracellular trap formation mleu05034   Alcoholism mleu05202   Transcriptional misregulation in cancer mleu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105543183  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105543183   09163 Immune disease    05322 Systemic lupus erythematosus     105543183   09165 Substance dependence    05034 Alcoholism     105543183  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mleu03036]     105543183   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105543183 Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105543183 Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105543183 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  105543183 NCBI-ProteinID:  XP_011840374 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKATNWQAPRKPLATKAPGKRLPPRGGIKKPHRYRPGTQALREIRKYQKSTQ LLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASEAYLVSLFEDTNLCAIHARRVTI MPRDMQLARRIRREGA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcaccaagcagaccgcccggaaagccaccaactggcaggcccccaggaagccc ctggccaccaaagccccaggcaagaggttgccgcctagaggagggatcaagaagcctcac cgctataggcctggcacccaggcgctgcgcgaaatcagaaagtaccagaagtccacgcag ctgctcctgcgcaagctgcctttccagcgcctggtgcgcgagatcgcccaggccatcagc ccggacctgcgcttccagagcgcggccattggcgccctgcaggaggccagcgaggcctac ctggtgagcctctttgaagataccaacctgtgtgccatccatgccagacgtgtcacaatt atgcccagagacatgcagctggcccgccgcatccgcagagagggtgcttaa

DBGET integrated database retrieval system