Mandrillus leucophaeus (drill): 105544325 Help Entry 105544325         CDS       T08763                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04621   NOD-like receptor signaling pathway mleu05012   Parkinson disease mleu05132   Salmonella infection mleu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105544325  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105544325   09164 Neurodegenerative disease    05012 Parkinson disease     105544325   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105544325  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mleu03110]     105544325 Chaperones and folding catalysts [BR:mleu03110]  Protein folding catalysts   Protein disulfide isomerase    105544325 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 OST3_OST6 Thioredoxin_2 AhpC-TSA Thioredoxin_7 Thioredoxin_9 Redoxin Glutaredoxin Motif Other DBs NCBI-GeneID:  105544325 NCBI-ProteinID:  XP_011842155 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MVKQIESKAAFQEALNTAGDKLVVVDFSATWCGPCKTIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATIN NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggtaaagcagatcgagagcaaggctgcttttcaggaagccctgaacaccgcaggtgat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaacgatcaagcct ttctttcattccctctctgaaaagtattccaacgtggtattccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt aagaagggacaaaaagtgggtgaattttctggagccaataaggaaaagcttgaagccacc attaattaa

DBGET integrated database retrieval system