KEGG   Mandrillus leucophaeus (drill): 105544764
Entry
105544764         CDS       T08763                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mleu  Mandrillus leucophaeus (drill)
Pathway
mleu01521  EGFR tyrosine kinase inhibitor resistance
mleu01522  Endocrine resistance
mleu01524  Platinum drug resistance
mleu04010  MAPK signaling pathway
mleu04012  ErbB signaling pathway
mleu04014  Ras signaling pathway
mleu04015  Rap1 signaling pathway
mleu04022  cGMP-PKG signaling pathway
mleu04024  cAMP signaling pathway
mleu04062  Chemokine signaling pathway
mleu04066  HIF-1 signaling pathway
mleu04068  FoxO signaling pathway
mleu04071  Sphingolipid signaling pathway
mleu04072  Phospholipase D signaling pathway
mleu04114  Oocyte meiosis
mleu04140  Autophagy - animal
mleu04148  Efferocytosis
mleu04150  mTOR signaling pathway
mleu04151  PI3K-Akt signaling pathway
mleu04210  Apoptosis
mleu04218  Cellular senescence
mleu04261  Adrenergic signaling in cardiomyocytes
mleu04270  Vascular smooth muscle contraction
mleu04350  TGF-beta signaling pathway
mleu04360  Axon guidance
mleu04370  VEGF signaling pathway
mleu04371  Apelin signaling pathway
mleu04380  Osteoclast differentiation
mleu04510  Focal adhesion
mleu04520  Adherens junction
mleu04540  Gap junction
mleu04550  Signaling pathways regulating pluripotency of stem cells
mleu04611  Platelet activation
mleu04613  Neutrophil extracellular trap formation
mleu04620  Toll-like receptor signaling pathway
mleu04621  NOD-like receptor signaling pathway
mleu04625  C-type lectin receptor signaling pathway
mleu04650  Natural killer cell mediated cytotoxicity
mleu04657  IL-17 signaling pathway
mleu04658  Th1 and Th2 cell differentiation
mleu04659  Th17 cell differentiation
mleu04660  T cell receptor signaling pathway
mleu04662  B cell receptor signaling pathway
mleu04664  Fc epsilon RI signaling pathway
mleu04666  Fc gamma R-mediated phagocytosis
mleu04668  TNF signaling pathway
mleu04713  Circadian entrainment
mleu04720  Long-term potentiation
mleu04722  Neurotrophin signaling pathway
mleu04723  Retrograde endocannabinoid signaling
mleu04724  Glutamatergic synapse
mleu04725  Cholinergic synapse
mleu04726  Serotonergic synapse
mleu04730  Long-term depression
mleu04810  Regulation of actin cytoskeleton
mleu04910  Insulin signaling pathway
mleu04912  GnRH signaling pathway
mleu04914  Progesterone-mediated oocyte maturation
mleu04915  Estrogen signaling pathway
mleu04916  Melanogenesis
mleu04917  Prolactin signaling pathway
mleu04919  Thyroid hormone signaling pathway
mleu04921  Oxytocin signaling pathway
mleu04926  Relaxin signaling pathway
mleu04928  Parathyroid hormone synthesis, secretion and action
mleu04929  GnRH secretion
mleu04930  Type II diabetes mellitus
mleu04933  AGE-RAGE signaling pathway in diabetic complications
mleu04934  Cushing syndrome
mleu04935  Growth hormone synthesis, secretion and action
mleu04960  Aldosterone-regulated sodium reabsorption
mleu05010  Alzheimer disease
mleu05020  Prion disease
mleu05022  Pathways of neurodegeneration - multiple diseases
mleu05034  Alcoholism
mleu05132  Salmonella infection
mleu05133  Pertussis
mleu05135  Yersinia infection
mleu05140  Leishmaniasis
mleu05142  Chagas disease
mleu05145  Toxoplasmosis
mleu05152  Tuberculosis
mleu05160  Hepatitis C
mleu05161  Hepatitis B
mleu05163  Human cytomegalovirus infection
mleu05164  Influenza A
mleu05165  Human papillomavirus infection
mleu05166  Human T-cell leukemia virus 1 infection
mleu05167  Kaposi sarcoma-associated herpesvirus infection
mleu05170  Human immunodeficiency virus 1 infection
mleu05171  Coronavirus disease - COVID-19
mleu05200  Pathways in cancer
mleu05203  Viral carcinogenesis
mleu05205  Proteoglycans in cancer
mleu05206  MicroRNAs in cancer
mleu05207  Chemical carcinogenesis - receptor activation
mleu05208  Chemical carcinogenesis - reactive oxygen species
mleu05210  Colorectal cancer
mleu05211  Renal cell carcinoma
mleu05212  Pancreatic cancer
mleu05213  Endometrial cancer
mleu05214  Glioma
mleu05215  Prostate cancer
mleu05216  Thyroid cancer
mleu05218  Melanoma
mleu05219  Bladder cancer
mleu05220  Chronic myeloid leukemia
mleu05221  Acute myeloid leukemia
mleu05223  Non-small cell lung cancer
mleu05224  Breast cancer
mleu05225  Hepatocellular carcinoma
mleu05226  Gastric cancer
mleu05230  Central carbon metabolism in cancer
mleu05231  Choline metabolism in cancer
mleu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mleu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mleu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105544764 (MAPK1)
   04012 ErbB signaling pathway
    105544764 (MAPK1)
   04014 Ras signaling pathway
    105544764 (MAPK1)
   04015 Rap1 signaling pathway
    105544764 (MAPK1)
   04350 TGF-beta signaling pathway
    105544764 (MAPK1)
   04370 VEGF signaling pathway
    105544764 (MAPK1)
   04371 Apelin signaling pathway
    105544764 (MAPK1)
   04668 TNF signaling pathway
    105544764 (MAPK1)
   04066 HIF-1 signaling pathway
    105544764 (MAPK1)
   04068 FoxO signaling pathway
    105544764 (MAPK1)
   04072 Phospholipase D signaling pathway
    105544764 (MAPK1)
   04071 Sphingolipid signaling pathway
    105544764 (MAPK1)
   04024 cAMP signaling pathway
    105544764 (MAPK1)
   04022 cGMP-PKG signaling pathway
    105544764 (MAPK1)
   04151 PI3K-Akt signaling pathway
    105544764 (MAPK1)
   04150 mTOR signaling pathway
    105544764 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105544764 (MAPK1)
   04148 Efferocytosis
    105544764 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105544764 (MAPK1)
   04210 Apoptosis
    105544764 (MAPK1)
   04218 Cellular senescence
    105544764 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105544764 (MAPK1)
   04520 Adherens junction
    105544764 (MAPK1)
   04540 Gap junction
    105544764 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    105544764 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105544764 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105544764 (MAPK1)
   04613 Neutrophil extracellular trap formation
    105544764 (MAPK1)
   04620 Toll-like receptor signaling pathway
    105544764 (MAPK1)
   04621 NOD-like receptor signaling pathway
    105544764 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    105544764 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    105544764 (MAPK1)
   04660 T cell receptor signaling pathway
    105544764 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    105544764 (MAPK1)
   04659 Th17 cell differentiation
    105544764 (MAPK1)
   04657 IL-17 signaling pathway
    105544764 (MAPK1)
   04662 B cell receptor signaling pathway
    105544764 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    105544764 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    105544764 (MAPK1)
   04062 Chemokine signaling pathway
    105544764 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105544764 (MAPK1)
   04929 GnRH secretion
    105544764 (MAPK1)
   04912 GnRH signaling pathway
    105544764 (MAPK1)
   04915 Estrogen signaling pathway
    105544764 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    105544764 (MAPK1)
   04917 Prolactin signaling pathway
    105544764 (MAPK1)
   04921 Oxytocin signaling pathway
    105544764 (MAPK1)
   04926 Relaxin signaling pathway
    105544764 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    105544764 (MAPK1)
   04919 Thyroid hormone signaling pathway
    105544764 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    105544764 (MAPK1)
   04916 Melanogenesis
    105544764 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105544764 (MAPK1)
   04270 Vascular smooth muscle contraction
    105544764 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105544764 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    105544764 (MAPK1)
   04725 Cholinergic synapse
    105544764 (MAPK1)
   04726 Serotonergic synapse
    105544764 (MAPK1)
   04720 Long-term potentiation
    105544764 (MAPK1)
   04730 Long-term depression
    105544764 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    105544764 (MAPK1)
   04722 Neurotrophin signaling pathway
    105544764 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    105544764 (MAPK1)
   04380 Osteoclast differentiation
    105544764 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105544764 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105544764 (MAPK1)
   05206 MicroRNAs in cancer
    105544764 (MAPK1)
   05205 Proteoglycans in cancer
    105544764 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    105544764 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    105544764 (MAPK1)
   05203 Viral carcinogenesis
    105544764 (MAPK1)
   05230 Central carbon metabolism in cancer
    105544764 (MAPK1)
   05231 Choline metabolism in cancer
    105544764 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105544764 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105544764 (MAPK1)
   05212 Pancreatic cancer
    105544764 (MAPK1)
   05225 Hepatocellular carcinoma
    105544764 (MAPK1)
   05226 Gastric cancer
    105544764 (MAPK1)
   05214 Glioma
    105544764 (MAPK1)
   05216 Thyroid cancer
    105544764 (MAPK1)
   05221 Acute myeloid leukemia
    105544764 (MAPK1)
   05220 Chronic myeloid leukemia
    105544764 (MAPK1)
   05218 Melanoma
    105544764 (MAPK1)
   05211 Renal cell carcinoma
    105544764 (MAPK1)
   05219 Bladder cancer
    105544764 (MAPK1)
   05215 Prostate cancer
    105544764 (MAPK1)
   05213 Endometrial cancer
    105544764 (MAPK1)
   05224 Breast cancer
    105544764 (MAPK1)
   05223 Non-small cell lung cancer
    105544764 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105544764 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    105544764 (MAPK1)
   05161 Hepatitis B
    105544764 (MAPK1)
   05160 Hepatitis C
    105544764 (MAPK1)
   05171 Coronavirus disease - COVID-19
    105544764 (MAPK1)
   05164 Influenza A
    105544764 (MAPK1)
   05163 Human cytomegalovirus infection
    105544764 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105544764 (MAPK1)
   05165 Human papillomavirus infection
    105544764 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105544764 (MAPK1)
   05135 Yersinia infection
    105544764 (MAPK1)
   05133 Pertussis
    105544764 (MAPK1)
   05152 Tuberculosis
    105544764 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105544764 (MAPK1)
   05140 Leishmaniasis
    105544764 (MAPK1)
   05142 Chagas disease
    105544764 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105544764 (MAPK1)
   05020 Prion disease
    105544764 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    105544764 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    105544764 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105544764 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105544764 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105544764 (MAPK1)
   04934 Cushing syndrome
    105544764 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105544764 (MAPK1)
   01524 Platinum drug resistance
    105544764 (MAPK1)
   01522 Endocrine resistance
    105544764 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mleu01001]
    105544764 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mleu03036]
    105544764 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mleu04147]
    105544764 (MAPK1)
Enzymes [BR:mleu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105544764 (MAPK1)
Protein kinases [BR:mleu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105544764 (MAPK1)
Chromosome and associated proteins [BR:mleu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105544764 (MAPK1)
Exosome [BR:mleu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105544764 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Other DBs
NCBI-GeneID: 105544764
NCBI-ProteinID: XP_011842741
LinkDB
Position
Unknown
AA seq 263 aa
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaagatgtatatatagtacaagacctcatggaaacagatctttacaagctcttgaag
acacaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagctaacgttctgcaccgtgacctcaagccttccaacctgctgctc
aacaccacctgtgatctcaagatctgtgactttggcctggcccgtgttgcagatccagac
catgatcacacagggttcctgacagaatatgtggctacacgttggtacagggctccagaa
attatgttgaattccaagggctacaccaagtccattgatatttggtctgtaggctgcatt
ctggcagaaatgctttctaacaggcccatctttccagggaagcattatcttgaccagctg
aaccacattctgggtattcttggatccccatcacaagaagacctgaattgtataataaat
ttaaaagctaggaactatttgctttctcttccacacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctggacttactggacaaaatgttgacattcaac
cctcacaagaggattgaagtagaacaggctctggcccacccatatctggagcagtattac
gacccgagtgacgagcccattgccgaagcaccattcaagttcgacatggaattggatgac
ttgcctaaggaaaagctcaaagaactaatttttgaagagactgctagattccagccggga
tacagatcttaa

DBGET integrated database retrieval system