Mandrillus leucophaeus (drill): 105545324 Help Entry 105545324         CDS       T08763                                  Symbol INS Name (RefSeq) insulin isoform X1   KO K04526   insulin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04010   MAPK signaling pathway mleu04014   Ras signaling pathway mleu04015   Rap1 signaling pathway mleu04022   cGMP-PKG signaling pathway mleu04066   HIF-1 signaling pathway mleu04068   FoxO signaling pathway mleu04072   Phospholipase D signaling pathway mleu04081   Hormone signaling mleu04114   Oocyte meiosis mleu04140   Autophagy - animal mleu04150   mTOR signaling pathway mleu04151   PI3K-Akt signaling pathway mleu04152   AMPK signaling pathway mleu04211   Longevity regulating pathway mleu04213   Longevity regulating pathway - multiple species mleu04810   Regulation of actin cytoskeleton mleu04910   Insulin signaling pathway mleu04911   Insulin secretion mleu04913   Ovarian steroidogenesis mleu04914   Progesterone-mediated oocyte maturation mleu04917   Prolactin signaling pathway mleu04923   Regulation of lipolysis in adipocytes mleu04930   Type II diabetes mellitus mleu04931   Insulin resistance mleu04932   Non-alcoholic fatty liver disease mleu04940   Type I diabetes mellitus mleu04950   Maturity onset diabetes of the young mleu04960   Aldosterone-regulated sodium reabsorption mleu05010   Alzheimer disease mleu05215   Prostate cancer mleu05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105545324 (INS)    04014 Ras signaling pathway     105545324 (INS)    04015 Rap1 signaling pathway     105545324 (INS)    04066 HIF-1 signaling pathway     105545324 (INS)    04068 FoxO signaling pathway     105545324 (INS)    04072 Phospholipase D signaling pathway     105545324 (INS)    04022 cGMP-PKG signaling pathway     105545324 (INS)    04151 PI3K-Akt signaling pathway     105545324 (INS)    04152 AMPK signaling pathway     105545324 (INS)    04150 mTOR signaling pathway     105545324 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     105545324 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105545324 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     105545324 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105545324 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     105545324 (INS)    04910 Insulin signaling pathway     105545324 (INS)    04923 Regulation of lipolysis in adipocytes     105545324 (INS)    04913 Ovarian steroidogenesis     105545324 (INS)    04914 Progesterone-mediated oocyte maturation     105545324 (INS)    04917 Prolactin signaling pathway     105545324 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     105545324 (INS)   09149 Aging    04211 Longevity regulating pathway     105545324 (INS)    04213 Longevity regulating pathway - multiple species     105545324 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     105545324 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105545324 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     105545324 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     105545324 (INS)    04940 Type I diabetes mellitus     105545324 (INS)    04950 Maturity onset diabetes of the young     105545324 (INS)    04932 Non-alcoholic fatty liver disease     105545324 (INS)    04931 Insulin resistance     105545324 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105545324 (INS) Cytokines and neuropeptides [BR:mleu04052]  Neuropeptides   Unclassified    105545324 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  105545324 NCBI-ProteinID:  XP_011843615 Ensembl:  ENSMLEG00000032291 UniProt:  A0A2K5YKV7 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MALWMRLLPLLALLALWGPDPVPAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED PQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac ccggtcccggcctttgtgaaccagcacctgtgcggctcccacctggtggaagctctctac ctggtgtgcggggagcgaggcttcttctacacacccaagacccgccgggaggcagaggac cctcaggtggggcaggtggagctgggcgggggccccggcgcaggcagcctgcagcccttg gcgctggaggggtccctgcagaagcgcggcatcgtggagcagtgctgcaccagcatctgc tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system