Mandrillus leucophaeus (drill): 105546067 Help Entry 105546067         CDS       T08763                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04613   Neutrophil extracellular trap formation mleu05034   Alcoholism mleu05202   Transcriptional misregulation in cancer mleu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105546067  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105546067   09163 Immune disease    05322 Systemic lupus erythematosus     105546067   09165 Substance dependence    05034 Alcoholism     105546067  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mleu03036]     105546067   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105546067 Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105546067 Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105546067 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  105546067 NCBI-ProteinID:  XP_011844548 Ensembl:  ENSMLEG00000009871 UniProt:  A0A2K5XGL5 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTACKSTSGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEPYLVGLFEDTNLCAIHAKRVTI MPKDIQLACRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcctgcaaatcgaccagtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggccctccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgagccctat ctggttggcctttttgaagacactaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcatgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system