Mandrillus leucophaeus (drill): 105546370 Help Entry 105546370         CDS       T08763                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04081   Hormone signaling mleu04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     105546370 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     105546370 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105546370 (GAST) Cytokines and neuropeptides [BR:mleu04052]  Neuropeptides   GPCR binding    105546370 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  105546370 NCBI-ProteinID:  XP_011844943 Ensembl:  ENSMLEG00000035133 UniProt:  A0A2K5Z217 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQQLCVYVLIFALALAAFSEASWKPRSQQPDAPLGRGANRNLELPWLDQQGPASHHRRQL GPQGPPQLVADPSKKQGPWMEEEEAAYGWMDFGRRSAEDENQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcaactgtgtgtgtatgtgctgatctttgccctggctctggctgccttctctgaa gcttcttggaagccccgctcccagcagccagatgcacccttaggtagaggggccaacagg aacctggagctaccctggctggaccagcaaggcccagcctctcaccaccgaaggcagctg ggaccccagggtcccccacaactcgtggcagacccatccaagaagcagggaccatggatg gaggaagaagaagcagcctatggatggatggactttggccgccgcagtgccgaggatgag aaccaacaaccctag

DBGET integrated database retrieval system