Mandrillus leucophaeus (drill): 105546567 Help Entry 105546567         CDS       T08763                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04010   MAPK signaling pathway mleu04014   Ras signaling pathway mleu04015   Rap1 signaling pathway mleu04024   cAMP signaling pathway mleu04062   Chemokine signaling pathway mleu04071   Sphingolipid signaling pathway mleu04145   Phagosome mleu04148   Efferocytosis mleu04151   PI3K-Akt signaling pathway mleu04310   Wnt signaling pathway mleu04360   Axon guidance mleu04370   VEGF signaling pathway mleu04380   Osteoclast differentiation mleu04510   Focal adhesion mleu04520   Adherens junction mleu04530   Tight junction mleu04613   Neutrophil extracellular trap formation mleu04620   Toll-like receptor signaling pathway mleu04650   Natural killer cell mediated cytotoxicity mleu04662   B cell receptor signaling pathway mleu04664   Fc epsilon RI signaling pathway mleu04666   Fc gamma R-mediated phagocytosis mleu04670   Leukocyte transendothelial migration mleu04722   Neurotrophin signaling pathway mleu04810   Regulation of actin cytoskeleton mleu04932   Non-alcoholic fatty liver disease mleu04933   AGE-RAGE signaling pathway in diabetic complications mleu04972   Pancreatic secretion mleu05014   Amyotrophic lateral sclerosis mleu05020   Prion disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05100   Bacterial invasion of epithelial cells mleu05132   Salmonella infection mleu05135   Yersinia infection mleu05163   Human cytomegalovirus infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05169   Epstein-Barr virus infection mleu05170   Human immunodeficiency virus 1 infection mleu05200   Pathways in cancer mleu05203   Viral carcinogenesis mleu05205   Proteoglycans in cancer mleu05208   Chemical carcinogenesis - reactive oxygen species mleu05210   Colorectal cancer mleu05211   Renal cell carcinoma mleu05212   Pancreatic cancer mleu05231   Choline metabolism in cancer mleu05415   Diabetic cardiomyopathy mleu05416   Viral myocarditis mleu05417   Lipid and atherosclerosis mleu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105546567    04014 Ras signaling pathway     105546567    04015 Rap1 signaling pathway     105546567    04310 Wnt signaling pathway     105546567    04370 VEGF signaling pathway     105546567    04071 Sphingolipid signaling pathway     105546567    04024 cAMP signaling pathway     105546567    04151 PI3K-Akt signaling pathway     105546567  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105546567    04148 Efferocytosis     105546567   09144 Cellular community - eukaryotes    04510 Focal adhesion     105546567    04520 Adherens junction     105546567    04530 Tight junction     105546567   09142 Cell motility    04810 Regulation of actin cytoskeleton     105546567  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105546567    04620 Toll-like receptor signaling pathway     105546567    04650 Natural killer cell mediated cytotoxicity     105546567    04662 B cell receptor signaling pathway     105546567    04664 Fc epsilon RI signaling pathway     105546567    04666 Fc gamma R-mediated phagocytosis     105546567    04670 Leukocyte transendothelial migration     105546567    04062 Chemokine signaling pathway     105546567   09154 Digestive system    04972 Pancreatic secretion     105546567   09156 Nervous system    04722 Neurotrophin signaling pathway     105546567   09158 Development and regeneration    04360 Axon guidance     105546567    04380 Osteoclast differentiation     105546567  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105546567    05205 Proteoglycans in cancer     105546567    05208 Chemical carcinogenesis - reactive oxygen species     105546567    05203 Viral carcinogenesis     105546567    05231 Choline metabolism in cancer     105546567   09162 Cancer: specific types    05210 Colorectal cancer     105546567    05212 Pancreatic cancer     105546567    05211 Renal cell carcinoma     105546567   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105546567    05163 Human cytomegalovirus infection     105546567    05167 Kaposi sarcoma-associated herpesvirus infection     105546567    05169 Epstein-Barr virus infection     105546567   09171 Infectious disease: bacterial    05132 Salmonella infection     105546567    05135 Yersinia infection     105546567    05100 Bacterial invasion of epithelial cells     105546567   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105546567    05020 Prion disease     105546567    05022 Pathways of neurodegeneration - multiple diseases     105546567   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105546567    05418 Fluid shear stress and atherosclerosis     105546567    05415 Diabetic cardiomyopathy     105546567    05416 Viral myocarditis     105546567   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105546567    04933 AGE-RAGE signaling pathway in diabetic complications     105546567  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mleu04131]     105546567   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105546567    04031 GTP-binding proteins [BR:mleu04031]     105546567 Membrane trafficking [BR:mleu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105546567  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105546567   Macropinocytosis    Ras GTPases     105546567  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105546567 Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105546567   Exosomal proteins of other body fluids (saliva and urine)    105546567   Exosomal proteins of colorectal cancer cells    105546567   Exosomal proteins of bladder cancer cells    105546567 GTP-binding proteins [BR:mleu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105546567 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  105546567 NCBI-ProteinID:  XP_011845192 LinkDB All DBs Position Unknown AA seq 265 aa AA seqDB search MQAIRGVVVGDGAAGETCLLISYTTNAFPGEYIPTVFDNYSANVMVDRKPVNLGLWDTAA QEDYDRSCPVSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHRPNTPIILVGTELELR DDKDTIEKLKKKLTPITYLQGLAIAKETGAVKYLECSALWDTAAQEDYDRSCPLSYPQTD VFLICFSLVSPASFENVRAKWYPEVRHHRPNTPIILVGTELELRDDKDTIEKLKKKLTPI TYLQGLAIAKETGAVKYLECSAFTQ NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atgcaggccatcaggggtgtggtggtgggagacggagctgcaggtgaaacttgcctactg atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat tctgccaatgttatggtagatagaaaaccagtgaatctgggcttatgggatacagctgct caagaagattatgacagatcatgccccgtatcctatcctcaaacagatgtgttcttaatt tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag gtgcggcaccaccgtcccaacactcccatcatcctagtgggaactgaacttgaacttagg gatgataaagacacgatcgagaaactgaagaagaagctgactcccatcacctatctgcag ggtctagctatagctaaggagactggtgctgtaaaatacctggagtgctcggccttatgg gatacagctgctcaagaagattatgacagatcatgccccctatcctatcctcaaacagat gtgttcttaatttgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaag tggtatcctgaggtgcggcaccaccgtcccaacactcccatcatcctagtgggaactgaa cttgaacttagggatgataaagacacgatcgagaaactgaagaagaagctgactcccatc acctatctgcagggtctagctatagctaaggagactggtgctgtaaaatacctggagtgc tcggctttcacacagtga

DBGET integrated database retrieval system