Mandrillus leucophaeus (drill): 105546707 Help Entry 105546707         CDS       T08763                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04015   Rap1 signaling pathway mleu04810   Regulation of actin cytoskeleton mleu05014   Amyotrophic lateral sclerosis mleu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105546707 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105546707 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105546707 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105546707 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mleu04131]     105546707 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mleu04812]     105546707 (PFN3)    04147 Exosome [BR:mleu04147]     105546707 (PFN3) Membrane trafficking [BR:mleu04131]  Others   Actin-binding proteins    Others     105546707 (PFN3) Cytoskeleton proteins [BR:mleu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105546707 (PFN3) Exosome [BR:mleu04147]  Exosomal proteins   Proteins found in most exosomes    105546707 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  105546707 NCBI-ProteinID:  XP_011845349 Ensembl:  ENSMLEG00000024951 UniProt:  A0A2K5XR51 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRCTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDPRAVCVGHAPRALLVLMGRRGVHGGI LNKTMHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgttgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggataacagctgcgtgtgggcttcgcggcccgggggcctgctg gctgccatctcgccgcaggaggtgggcgtgctcacggggcccgaccgctgcaccttcctg caggcgggcctgagcgtgggcggccgccgctgctgcgtcatccgcgaccacctgctggcg gagggcgacggcgtgctggacgcacgcaccaagggtctggacccgcgcgccgtgtgcgtg ggccacgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc ctcaacaagacgatgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system