Mandrillus leucophaeus (drill): 105546762 Help Entry 105546762         CDS       T08763                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04010   MAPK signaling pathway mleu04020   Calcium signaling pathway mleu04022   cGMP-PKG signaling pathway mleu04114   Oocyte meiosis mleu04218   Cellular senescence mleu04310   Wnt signaling pathway mleu04360   Axon guidance mleu04370   VEGF signaling pathway mleu04380   Osteoclast differentiation mleu04625   C-type lectin receptor signaling pathway mleu04650   Natural killer cell mediated cytotoxicity mleu04658   Th1 and Th2 cell differentiation mleu04659   Th17 cell differentiation mleu04660   T cell receptor signaling pathway mleu04662   B cell receptor signaling pathway mleu04720   Long-term potentiation mleu04724   Glutamatergic synapse mleu04921   Oxytocin signaling pathway mleu04922   Glucagon signaling pathway mleu04924   Renin secretion mleu05010   Alzheimer disease mleu05014   Amyotrophic lateral sclerosis mleu05020   Prion disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05031   Amphetamine addiction mleu05152   Tuberculosis mleu05163   Human cytomegalovirus infection mleu05166   Human T-cell leukemia virus 1 infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05170   Human immunodeficiency virus 1 infection mleu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mleu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105546762 (PPP3R2)    04310 Wnt signaling pathway     105546762 (PPP3R2)    04370 VEGF signaling pathway     105546762 (PPP3R2)    04020 Calcium signaling pathway     105546762 (PPP3R2)    04022 cGMP-PKG signaling pathway     105546762 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     105546762 (PPP3R2)    04218 Cellular senescence     105546762 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105546762 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     105546762 (PPP3R2)    04660 T cell receptor signaling pathway     105546762 (PPP3R2)    04658 Th1 and Th2 cell differentiation     105546762 (PPP3R2)    04659 Th17 cell differentiation     105546762 (PPP3R2)    04662 B cell receptor signaling pathway     105546762 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     105546762 (PPP3R2)    04921 Oxytocin signaling pathway     105546762 (PPP3R2)    04924 Renin secretion     105546762 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     105546762 (PPP3R2)    04720 Long-term potentiation     105546762 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     105546762 (PPP3R2)    04380 Osteoclast differentiation     105546762 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105546762 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105546762 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     105546762 (PPP3R2)    05163 Human cytomegalovirus infection     105546762 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     105546762 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     105546762 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     105546762 (PPP3R2)    05014 Amyotrophic lateral sclerosis     105546762 (PPP3R2)    05020 Prion disease     105546762 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     105546762 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     105546762 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105546762 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mleu01009]     105546762 (PPP3R2) Protein phosphatases and associated proteins [BR:mleu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      105546762 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 flgK_1st_1 Motif Other DBs NCBI-GeneID:  105546762 NCBI-ProteinID:  XP_011845425 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTNDDGEVDFKEFILGASQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLPDWQLQQLVDKTILILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgcgcccactttgacaat gatgaaattaaaaggctgggcaggaggtttcggaagttggacttggacaaatcaggctct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccaacgacgatggagaagtggacttcaaggaattcatcctg ggggcctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgtttagc atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgccggactggcagctccagcagctggtcgacaaaaccatc ctcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system