Mandrillus leucophaeus (drill): 105547590 Help Entry 105547590         CDS       T08763                                  Name (RefSeq) histone H2B type 1-M-like   KO K11252   histone H2B Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04613   Neutrophil extracellular trap formation mleu05034   Alcoholism mleu05203   Viral carcinogenesis mleu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105547590  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     105547590   09163 Immune disease    05322 Systemic lupus erythematosus     105547590   09165 Substance dependence    05034 Alcoholism     105547590  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mleu03036]     105547590   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105547590 Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105547590 Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105547590 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  105547590 NCBI-ProteinID:  XP_011846637 Ensembl:  ENSMLEG00000001367 UniProt:  A0A2K5XAZ0 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPLKSASAPKKGSKKAINKAQKKDGKKRKRGRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccactaaaatctgcttcagcccctaaaaagggctccaagaaggccattaac aaggctcagaagaaggatggaaagaagcggaaacgcggccgcaaggaaagctactccgtg tacgtgtacaaagtgctgaagcaagtccaccccgacaccggcatttcctccaaggctatg gggattatgaactcctttgtcaacgacatcttcgagcgtatcgccggagaagcgtcacgc ctggcgcattataacaagcgctcgaccatcacttcgagggagattcagacggccgtgcgc ctactgctgcccggggagttggccaagcatgccgtgtccgagggcaccaaggccgtcacc aagtataccagctccaagtga

DBGET integrated database retrieval system