Mandrillus leucophaeus (drill): 105549623 Help Entry 105549623         CDS       T08763                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mleu  Mandrillus leucophaeus (drill) Brite KEGG Orthology (KO) [BR:mleu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mleu03041]     105549623 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105549623 (UBL5) Spliceosome [BR:mleu03041]  Complex B   Other components    Complex B specific factors     105549623 (UBL5) Cytokines and neuropeptides [BR:mleu04052]  Neuropeptides   Unclassified    105549623 (UBL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  105549623 NCBI-ProteinID:  XP_011849628 Ensembl:  ENSMLEG00000028569 UniProt:  A0A2K5XZI0 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccggctggggaagaaggtccgcgttaaatgcaacacg gatgatactatcggggaccttaagaagctgattgcagcccaaactggcacccgttggaac aagattgtcctgaagaagtggtacacgatttttaaggaccacgtgtctctgggggactat gaaatccacgatgggatgaacctggagctttattaccaatag

DBGET integrated database retrieval system