Mandrillus leucophaeus (drill): 105549954 Help Entry 105549954         CDS       T08763                                  Symbol PFN1 Name (RefSeq) profilin-1 isoform X1   KO K05759   profilin Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04015   Rap1 signaling pathway mleu04810   Regulation of actin cytoskeleton mleu05014   Amyotrophic lateral sclerosis mleu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105549954 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105549954 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105549954 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105549954 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mleu04131]     105549954 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mleu04812]     105549954 (PFN1)    04147 Exosome [BR:mleu04147]     105549954 (PFN1) Membrane trafficking [BR:mleu04131]  Others   Actin-binding proteins    Others     105549954 (PFN1) Cytoskeleton proteins [BR:mleu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105549954 (PFN1) Exosome [BR:mleu04147]  Exosomal proteins   Proteins found in most exosomes    105549954 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105549954 NCBI-ProteinID:  XP_011850100 Ensembl:  ENSMLEG00000042209 UniProt:  A0A2K6A801 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MGAWFLFQPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGA PTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgggcgcttggttcctcttccagccagctgaggtgggtgtcctggttggcaaagaccgg tcaagtttttacgtcaatgggctgacacttgggggccagaaatgttcggtgatccgggac tcactgctgcaggatggggagtttagcatggatcttcgtaccaagagcaccggtggggcc cccaccttcaatgtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaa gaaggtgtccacggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcgg cgctcccagtactga

DBGET integrated database retrieval system