Mandrillus leucophaeus (drill): 105551971
Help
Entry
105551971 CDS
T08763
Symbol
DIRAS1
Name
(RefSeq) GTP-binding protein Di-Ras1
KO
K07840
DIRAS family, GTP-binding Ras-like 1
Organism
mleu
Mandrillus leucophaeus (drill)
Brite
KEGG Orthology (KO) [BR:
mleu00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:
mleu04031
]
105551971 (DIRAS1)
GTP-binding proteins [BR:
mleu04031
]
Small (monomeric) G-proteins
Ras Family
Di-Ras [OT]
105551971 (DIRAS1)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Ras
Roc
RsgA_GTPase
Arf
GTP_EFTU
MMR_HSR1_Xtn
MMR_HSR1
Gtr1_RagA
FeoB_N
AAA_24
AAA_16
nSTAND1
SRPRB
Motif
Other DBs
NCBI-GeneID:
105551971
NCBI-ProteinID:
XP_011852839
Ensembl:
ENSMLEG00000027735
UniProt:
A0A2K5XVR3
LinkDB
All DBs
Position
Unknown
AA seq
198 aa
AA seq
DB search
MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQIT
DTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVG
NKCDETQREVDTHEAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGK
RSGKQKRTDRVKGKCTLM
NT seq
597 nt
NT seq
+upstream
nt +downstream
nt
atgcccgaacagagcaatgactaccgcgtggtggtgttcggggcgggcggcgtgggcaag
agctcactggtgctgcgcttcgtgaagggcacgttccgcgacacgtacatccctaccatc
gaggacacctaccggcaggtgatcagctgcgacaagagcgtgtgcacgctgcagatcaca
gacaccaccggcagccaccagttcccggccatgcagcgcttgtccatctccaagggccac
gccttcatcctggtgttctcggtcaccagcaagcagtccctggaggagctggggcccatc
tacaagctcatcgtgcagatcaagggcagcgtggaggacatccccgtgatgctcgtgggc
aacaagtgcgacgagacgcagcgggaggtggacacgcacgaggcgcaggcggtggcccag
gagtggaagtgcgccttcatggagacctcggccaagatgaactacaacgtcaaggagctc
ttccaggagctactgacgctggagacccgccggaacatgagcctcaacatcgacggcaag
cgctccgggaagcagaagaggacagaccgcgtcaagggcaaatgcaccctcatgtga
DBGET
integrated database retrieval system