Mandrillus leucophaeus (drill): 105552337 Help Entry 105552337         CDS       T08763                                  Symbol H3F3A Name (RefSeq) histone H3.3 isoform X1   KO K11253   histone H3 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04613   Neutrophil extracellular trap formation mleu05034   Alcoholism mleu05202   Transcriptional misregulation in cancer mleu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mleu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105552337 (H3F3A)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105552337 (H3F3A)   09163 Immune disease    05322 Systemic lupus erythematosus     105552337 (H3F3A)   09165 Substance dependence    05034 Alcoholism     105552337 (H3F3A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mleu03036]     105552337 (H3F3A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105552337 (H3F3A) Chromosome and associated proteins [BR:mleu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105552337 (H3F3A) Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105552337 (H3F3A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  105552337 NCBI-ProteinID:  XP_011853354 Ensembl:  ENSMLEG00000041187 UniProt:  A0A2K6A1Z3 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTCGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRCYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgacctgtggtaaagcacccaggaagcaa ttggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagatgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system