KEGG   Mandrillus leucophaeus (drill): 105553159
Entry
105553159         CDS       T08763                                 
Symbol
KCNE2
Name
(RefSeq) potassium voltage-gated channel subfamily E member 2
  KO
K04896  potassium voltage-gated channel Isk-related subfamily E member 2
Organism
mleu  Mandrillus leucophaeus (drill)
Pathway
mleu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mleu00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    105553159 (KCNE2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mleu04040]
    105553159 (KCNE2)
Ion channels [BR:mleu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   105553159 (KCNE2)
SSDB
Motif
Pfam: ISK_Channel SLC52_ribofla_tr SID-1_RNA_chan CRA Viral_Beta_CD
Other DBs
NCBI-GeneID: 105553159
NCBI-ProteinID: XP_011854520
LinkDB
Position
Unknown
AA seq 123 aa
MSTLSNFTQTLEDVFQRIFITYMDNWRRNTTAEQEALQAKVDAENFYYVILYLMVIIGMF
SFIIVAILVSTVKSKRQEHSNDPYHQYIVEDWREKYKSQILNLEESKATIHENTGATGFK
MSP
NT seq 372 nt   +upstreamnt  +downstreamnt
atgtctactttatccaatttcacacagacgctggaagacgtcttccaaaggatttttatt
acttacatggacaattggcgccggaacacgacagctgagcaagaggccctccaagccaaa
gttgatgctgagaacttctactatgtcatcctgtacctcatggtgattattggaatgttc
tctttcattatcgtggccatcctggtgagcaccgtgaaatccaagagacaggaacactcc
aatgacccctaccaccagtacattgtagaggactggcgggaaaagtacaagagccaaatc
ttgaatctagaagaatcaaaggccaccatccatgagaatactggtgcgactgggttcaaa
atgtccccctga

DBGET integrated database retrieval system