Mandrillus leucophaeus (drill): 105553358 Help Entry 105553358         CDS       T08763                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04060   Cytokine-cytokine receptor interaction mleu04061   Viral protein interaction with cytokine and cytokine receptor mleu04062   Chemokine signaling pathway mleu04620   Toll-like receptor signaling pathway mleu04621   NOD-like receptor signaling pathway mleu04623   Cytosolic DNA-sensing pathway mleu04668   TNF signaling pathway mleu05020   Prion disease mleu05142   Chagas disease mleu05163   Human cytomegalovirus infection mleu05164   Influenza A mleu05168   Herpes simplex virus 1 infection mleu05323   Rheumatoid arthritis mleu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     105553358 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105553358 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     105553358 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105553358 (CCL5)    04621 NOD-like receptor signaling pathway     105553358 (CCL5)    04623 Cytosolic DNA-sensing pathway     105553358 (CCL5)    04062 Chemokine signaling pathway     105553358 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     105553358 (CCL5)    05168 Herpes simplex virus 1 infection     105553358 (CCL5)    05163 Human cytomegalovirus infection     105553358 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     105553358 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     105553358 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     105553358 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105553358 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mleu04052]     105553358 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:mleu00536]     105553358 (CCL5) Cytokines and neuropeptides [BR:mleu04052]  Cytokines   Chemokines    105553358 (CCL5) Glycosaminoglycan binding proteins [BR:mleu00536]  Heparan sulfate / Heparin   Chemokines    105553358 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  105553358 NCBI-ProteinID:  XP_011854801 Ensembl:  ENSMLEG00000033238 UniProt:  A0A2K5YRH3 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MKVSVAALAVILVATALCAPASASPHASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgtggctgccctcgctgtcatcctcgttgctacagccctctgcgctcct gcatctgcctccccacatgcctcagacaccacaccctgctgctttgcctacattgcccgc ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca gcagtcgtctttgtcacccgaaagaatcgccaagtgtgtgccaacccagagaagaaatgg gttcgggagtacatcaactctttggagatgagctag

DBGET integrated database retrieval system