Mandrillus leucophaeus (drill): 105553485 Help Entry 105553485         CDS       T08763                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu00190   Oxidative phosphorylation mleu01100   Metabolic pathways mleu01524   Platinum drug resistance mleu04115   p53 signaling pathway mleu04210   Apoptosis mleu04215   Apoptosis - multiple species mleu04932   Non-alcoholic fatty liver disease mleu05010   Alzheimer disease mleu05012   Parkinson disease mleu05014   Amyotrophic lateral sclerosis mleu05016   Huntington disease mleu05017   Spinocerebellar ataxia mleu05020   Prion disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05132   Salmonella infection mleu05134   Legionellosis mleu05145   Toxoplasmosis mleu05152   Tuberculosis mleu05160   Hepatitis C mleu05161   Hepatitis B mleu05162   Measles mleu05163   Human cytomegalovirus infection mleu05164   Influenza A mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05168   Herpes simplex virus 1 infection mleu05169   Epstein-Barr virus infection mleu05170   Human immunodeficiency virus 1 infection mleu05200   Pathways in cancer mleu05210   Colorectal cancer mleu05222   Small cell lung cancer mleu05416   Viral myocarditis mleu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     105553485  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     105553485  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105553485   09162 Cancer: specific types    05210 Colorectal cancer     105553485    05222 Small cell lung cancer     105553485   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105553485    05161 Hepatitis B     105553485    05160 Hepatitis C     105553485    05164 Influenza A     105553485    05162 Measles     105553485    05163 Human cytomegalovirus infection     105553485    05167 Kaposi sarcoma-associated herpesvirus infection     105553485    05169 Epstein-Barr virus infection     105553485   09171 Infectious disease: bacterial    05134 Legionellosis     105553485    05152 Tuberculosis     105553485   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105553485   09164 Neurodegenerative disease    05010 Alzheimer disease     105553485    05012 Parkinson disease     105553485    05014 Amyotrophic lateral sclerosis     105553485    05016 Huntington disease     105553485    05017 Spinocerebellar ataxia     105553485    05020 Prion disease     105553485    05022 Pathways of neurodegeneration - multiple diseases     105553485   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105553485    05416 Viral myocarditis     105553485   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     105553485   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     105553485 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  105553485 NCBI-ProteinID:  XP_011854962 Ensembl:  ENSMLEG00000006364 UniProt:  A0A2K5XEC2 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQARGYSYTAASKNKGITW GEDTLMEYLENPKKYIPGTKMIFVGIKKKEVRADLIAYLKKATNQ NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacact gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctctttgggaggaag acaggtcaggcccgtggatactcttacacagccgccagtaagaacaaaggcatcacctgg ggagaggatacactgatggaatatttggagaatcccaagaagtacatccctggaacaaaa atgatctttgtcggcattaagaagaaggaagtaagggcagacttgatagcttatctcaaa aaagctactaatcagtaa

DBGET integrated database retrieval system