Mandrillus leucophaeus (drill): 105553544 Help Entry 105553544         CDS       T08763                                  Symbol CRK Name (RefSeq) adapter molecule crk   KO K04438   C-crk adapter molecule crk Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu04010   MAPK signaling pathway mleu04012   ErbB signaling pathway mleu04015   Rap1 signaling pathway mleu04062   Chemokine signaling pathway mleu04148   Efferocytosis mleu04510   Focal adhesion mleu04666   Fc gamma R-mediated phagocytosis mleu04722   Neurotrophin signaling pathway mleu04810   Regulation of actin cytoskeleton mleu04910   Insulin signaling pathway mleu04935   Growth hormone synthesis, secretion and action mleu05100   Bacterial invasion of epithelial cells mleu05135   Yersinia infection mleu05163   Human cytomegalovirus infection mleu05170   Human immunodeficiency virus 1 infection mleu05200   Pathways in cancer mleu05206   MicroRNAs in cancer mleu05211   Renal cell carcinoma mleu05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105553544 (CRK)    04012 ErbB signaling pathway     105553544 (CRK)    04015 Rap1 signaling pathway     105553544 (CRK)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     105553544 (CRK)   09144 Cellular community - eukaryotes    04510 Focal adhesion     105553544 (CRK)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105553544 (CRK)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     105553544 (CRK)    04062 Chemokine signaling pathway     105553544 (CRK)   09152 Endocrine system    04910 Insulin signaling pathway     105553544 (CRK)    04935 Growth hormone synthesis, secretion and action     105553544 (CRK)   09156 Nervous system    04722 Neurotrophin signaling pathway     105553544 (CRK)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105553544 (CRK)    05206 MicroRNAs in cancer     105553544 (CRK)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     105553544 (CRK)    05211 Renal cell carcinoma     105553544 (CRK)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     105553544 (CRK)    05163 Human cytomegalovirus infection     105553544 (CRK)   09171 Infectious disease: bacterial    05135 Yersinia infection     105553544 (CRK)    05100 Bacterial invasion of epithelial cells     105553544 (CRK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SH3_2 SH3_1 SH3_9 SH3_10 DUF3804 Motif Other DBs NCBI-GeneID:  105553544 NCBI-ProteinID:  XP_011855037 LinkDB All DBs Position Unknown AA seq 238 aa AA seqDB search MTDSLPAHLGPTQGWVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSG VILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPY VEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKR VPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS NT seq 717 nt NT seq  +upstreamnt  +downstreamnt atgacggacagcttgcctgcacacttgggccccactcaaggatgggtgagcccctccaga ctccgaataggagatcaagagtttgattcattgcctgctttactggaattctacaaaata cactatttggacactacaacgttgatagaaccggtttccagatccaggcagggtagtgga gtgattctcaggcaggaggaggcggagtatgtgcgagccctctttgactttaatgggaat gatgaggaagatcttccctttaagaaaggagacatcttgagaatccgggacaagcctgaa gagcagtggtggaatgcggaggacagcgaaggcaagagagggatgattccagtcccttac gtcgagaagtatagacctgcctccgcctcagtatcggctctgattggaggtaaccaggag ggttcccacccacagccactgggtgggccggagcccgggccctatgcccaacccagcgtc aacactccgctccctaacctccagaatgggcccatatatgccagggttatccagaagcga gtccccaatgcctacgacaagacagccttggctttggaggtcggtgagctggtaaaggtt acgaagattaatgtgagtggtcagtgggaaggggagtgtaatggcaaacgaggtcacttc ccattcacacatgtccgtctgctggatcaacagaatcccgatgaggacttcagctga

DBGET integrated database retrieval system