Mandrillus leucophaeus (drill): 105554356 Help Entry 105554356         CDS       T08763                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism mleu  Mandrillus leucophaeus (drill) Pathway mleu01521   EGFR tyrosine kinase inhibitor resistance mleu01522   Endocrine resistance mleu04010   MAPK signaling pathway mleu04012   ErbB signaling pathway mleu04014   Ras signaling pathway mleu04015   Rap1 signaling pathway mleu04062   Chemokine signaling pathway mleu04068   FoxO signaling pathway mleu04071   Sphingolipid signaling pathway mleu04072   Phospholipase D signaling pathway mleu04137   Mitophagy - animal mleu04140   Autophagy - animal mleu04150   mTOR signaling pathway mleu04151   PI3K-Akt signaling pathway mleu04210   Apoptosis mleu04211   Longevity regulating pathway mleu04213   Longevity regulating pathway - multiple species mleu04218   Cellular senescence mleu04360   Axon guidance mleu04370   VEGF signaling pathway mleu04371   Apelin signaling pathway mleu04540   Gap junction mleu04550   Signaling pathways regulating pluripotency of stem cells mleu04625   C-type lectin receptor signaling pathway mleu04650   Natural killer cell mediated cytotoxicity mleu04660   T cell receptor signaling pathway mleu04662   B cell receptor signaling pathway mleu04664   Fc epsilon RI signaling pathway mleu04714   Thermogenesis mleu04720   Long-term potentiation mleu04722   Neurotrophin signaling pathway mleu04725   Cholinergic synapse mleu04726   Serotonergic synapse mleu04730   Long-term depression mleu04810   Regulation of actin cytoskeleton mleu04910   Insulin signaling pathway mleu04912   GnRH signaling pathway mleu04915   Estrogen signaling pathway mleu04916   Melanogenesis mleu04917   Prolactin signaling pathway mleu04919   Thyroid hormone signaling pathway mleu04921   Oxytocin signaling pathway mleu04926   Relaxin signaling pathway mleu04929   GnRH secretion mleu04933   AGE-RAGE signaling pathway in diabetic complications mleu04935   Growth hormone synthesis, secretion and action mleu05010   Alzheimer disease mleu05022   Pathways of neurodegeneration - multiple diseases mleu05034   Alcoholism mleu05160   Hepatitis C mleu05161   Hepatitis B mleu05163   Human cytomegalovirus infection mleu05165   Human papillomavirus infection mleu05166   Human T-cell leukemia virus 1 infection mleu05167   Kaposi sarcoma-associated herpesvirus infection mleu05170   Human immunodeficiency virus 1 infection mleu05200   Pathways in cancer mleu05203   Viral carcinogenesis mleu05205   Proteoglycans in cancer mleu05206   MicroRNAs in cancer mleu05207   Chemical carcinogenesis - receptor activation mleu05208   Chemical carcinogenesis - reactive oxygen species mleu05210   Colorectal cancer mleu05211   Renal cell carcinoma mleu05213   Endometrial cancer mleu05214   Glioma mleu05215   Prostate cancer mleu05216   Thyroid cancer mleu05218   Melanoma mleu05219   Bladder cancer mleu05220   Chronic myeloid leukemia mleu05221   Acute myeloid leukemia mleu05223   Non-small cell lung cancer mleu05224   Breast cancer mleu05225   Hepatocellular carcinoma mleu05226   Gastric cancer mleu05230   Central carbon metabolism in cancer mleu05231   Choline metabolism in cancer mleu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mleu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mleu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105554356 (NRAS)    04012 ErbB signaling pathway     105554356 (NRAS)    04014 Ras signaling pathway     105554356 (NRAS)    04015 Rap1 signaling pathway     105554356 (NRAS)    04370 VEGF signaling pathway     105554356 (NRAS)    04371 Apelin signaling pathway     105554356 (NRAS)    04068 FoxO signaling pathway     105554356 (NRAS)    04072 Phospholipase D signaling pathway     105554356 (NRAS)    04071 Sphingolipid signaling pathway     105554356 (NRAS)    04151 PI3K-Akt signaling pathway     105554356 (NRAS)    04150 mTOR signaling pathway     105554356 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105554356 (NRAS)    04137 Mitophagy - animal     105554356 (NRAS)   09143 Cell growth and death    04210 Apoptosis     105554356 (NRAS)    04218 Cellular senescence     105554356 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     105554356 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     105554356 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105554356 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     105554356 (NRAS)    04650 Natural killer cell mediated cytotoxicity     105554356 (NRAS)    04660 T cell receptor signaling pathway     105554356 (NRAS)    04662 B cell receptor signaling pathway     105554356 (NRAS)    04664 Fc epsilon RI signaling pathway     105554356 (NRAS)    04062 Chemokine signaling pathway     105554356 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     105554356 (NRAS)    04929 GnRH secretion     105554356 (NRAS)    04912 GnRH signaling pathway     105554356 (NRAS)    04915 Estrogen signaling pathway     105554356 (NRAS)    04917 Prolactin signaling pathway     105554356 (NRAS)    04921 Oxytocin signaling pathway     105554356 (NRAS)    04926 Relaxin signaling pathway     105554356 (NRAS)    04935 Growth hormone synthesis, secretion and action     105554356 (NRAS)    04919 Thyroid hormone signaling pathway     105554356 (NRAS)    04916 Melanogenesis     105554356 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     105554356 (NRAS)    04726 Serotonergic synapse     105554356 (NRAS)    04720 Long-term potentiation     105554356 (NRAS)    04730 Long-term depression     105554356 (NRAS)    04722 Neurotrophin signaling pathway     105554356 (NRAS)   09158 Development and regeneration    04360 Axon guidance     105554356 (NRAS)   09149 Aging    04211 Longevity regulating pathway     105554356 (NRAS)    04213 Longevity regulating pathway - multiple species     105554356 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     105554356 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105554356 (NRAS)    05206 MicroRNAs in cancer     105554356 (NRAS)    05205 Proteoglycans in cancer     105554356 (NRAS)    05207 Chemical carcinogenesis - receptor activation     105554356 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     105554356 (NRAS)    05203 Viral carcinogenesis     105554356 (NRAS)    05230 Central carbon metabolism in cancer     105554356 (NRAS)    05231 Choline metabolism in cancer     105554356 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105554356 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     105554356 (NRAS)    05225 Hepatocellular carcinoma     105554356 (NRAS)    05226 Gastric cancer     105554356 (NRAS)    05214 Glioma     105554356 (NRAS)    05216 Thyroid cancer     105554356 (NRAS)    05221 Acute myeloid leukemia     105554356 (NRAS)    05220 Chronic myeloid leukemia     105554356 (NRAS)    05218 Melanoma     105554356 (NRAS)    05211 Renal cell carcinoma     105554356 (NRAS)    05219 Bladder cancer     105554356 (NRAS)    05215 Prostate cancer     105554356 (NRAS)    05213 Endometrial cancer     105554356 (NRAS)    05224 Breast cancer     105554356 (NRAS)    05223 Non-small cell lung cancer     105554356 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105554356 (NRAS)    05170 Human immunodeficiency virus 1 infection     105554356 (NRAS)    05161 Hepatitis B     105554356 (NRAS)    05160 Hepatitis C     105554356 (NRAS)    05163 Human cytomegalovirus infection     105554356 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     105554356 (NRAS)    05165 Human papillomavirus infection     105554356 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105554356 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     105554356 (NRAS)   09165 Substance dependence    05034 Alcoholism     105554356 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105554356 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105554356 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105554356 (NRAS)    01522 Endocrine resistance     105554356 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mleu04131]     105554356 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mleu04147]     105554356 (NRAS)    04031 GTP-binding proteins [BR:mleu04031]     105554356 (NRAS) Membrane trafficking [BR:mleu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     105554356 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     105554356 (NRAS) Exosome [BR:mleu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105554356 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    105554356 (NRAS)   Exosomal proteins of breast cancer cells    105554356 (NRAS)   Exosomal proteins of colorectal cancer cells    105554356 (NRAS) GTP-binding proteins [BR:mleu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105554356 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ATPase_2 Hpr_kinase_C Ldh_1_N Motif Other DBs NCBI-GeneID:  105554356 NCBI-ProteinID:  XP_011856199 Ensembl:  ENSMLEG00000039333 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MAVPGSPTIFPAVVLNLSKAEAVELEVSSCWCEMTEYKLVVVGAGGVGKSALTIQLIQNH FVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNS KSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAK TRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atggcggttccggggtctccaacaattttccctgctgtggtcctgaatctgtccaaagca gaggcagtggagcttgaggtaagttcttgctggtgtgaaatgactgagtacaaactggtg gtggttggagcaggtggtgttgggaaaagcgcactgacaatccagctaatccagaaccac tttgtagatgaatatgatcccaccatagaggattcttacagaaaacaggtggttatagat ggtgaaacctgtttgttggacatactggatacagctggacaagaagagtacagtgccatg agagaccaatacatgaggacaggcgaaggcttcctctgtgtatttgccatcaataatagc aagtcatttgcggatattaacctctacagggagcagattaagcgagtaaaagactcggat gatgtacctatggtgctagtgggaaacaagtgtgatttgccaacaaggacagttgataca aaacaagcccacgaactggccaagagttacgggattccattcattgaaacctcagccaag accagacagggtgttgaagatgctttttacacactggtaagagaaatacgccagtaccga atgaaaaaactcaacagcagtgatgatgggactcagggttgtatgggattaccatgtgtg gtgatgtaa

DBGET integrated database retrieval system