Myotis lucifugus (little brown bat): 102418444 Help Entry 102418444         CDS       T07795                                  Symbol CLDN11 Name (RefSeq) claudin-11   KO K06087   claudin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf03272   Virion - Hepatitis viruses mlf04382   Cornified envelope formation mlf04514   Cell adhesion molecules mlf04530   Tight junction mlf04670   Leukocyte transendothelial migration mlf05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102418444 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102418444 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102418444 (CLDN11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102418444 (CLDN11)   09158 Development and regeneration    04382 Cornified envelope formation     102418444 (CLDN11)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102418444 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mlf03037]     102418444 (CLDN11)    04147 Exosome [BR:mlf04147]     102418444 (CLDN11)    04515 Cell adhesion molecules [BR:mlf04515]     102418444 (CLDN11) Cilium and associated proteins [BR:mlf03037]  Other cilia and associated proteins   Stereociliary proteins    102418444 (CLDN11) Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102418444 (CLDN11)   Exosomal proteins of colorectal cancer cells    102418444 (CLDN11) Cell adhesion molecules [BR:mlf04515]  Immunoglobulin superfamily   L1 family    102418444 (CLDN11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  102418444 NCBI-ProteinID:  XP_006088907 Ensembl:  ENSMLUG00000014961 UniProt:  G1PR77 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRA QLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAILCLVGGSVILCCAG DAQAFGENRFYYSSGSSSPTHAKSAHV NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggtggccacgtgcctgcaggttgtgggcttcgtcacgagcttcgtgggttggatcggg atcatcgtcaccacgtccaccaatgactgggtggtgacttgcggctacaccatcccgacg tgccgcaagctggacgagctgggctccaaggggctgtgggcggactgcgtcatggccacg gggctgtaccactgcaagcccctggtggacatcctcatcctgccgggttacgtgcaggcc tgccgagccctgatgatcgcagcctcagtcctgggcctgccggccattctcctgctgctg acagttctcccctgcatccgcatgggccatgagcctggcgtggccaagtacaggcgggcc cagctggctggggttctgctcattctgctggctctctgcgccattgttgccaccatctgg ttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtacgcc ggctggattggtgccattctctgcctcgtgggtggctctgtcatcctctgctgcgctgga gatgcgcaggcctttggtgaaaaccgtttctactactcttcgggctccagctcccccact cacgccaagagtgcccacgtataa

DBGET integrated database retrieval system