KEGG   Myotis lucifugus (little brown bat): 102419493
Entry
102419493         CDS       T07795                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
mlf  Myotis lucifugus (little brown bat)
Pathway
mlf04014  Ras signaling pathway
mlf04015  Rap1 signaling pathway
mlf04020  Calcium signaling pathway
mlf04022  cGMP-PKG signaling pathway
mlf04024  cAMP signaling pathway
mlf04070  Phosphatidylinositol signaling system
mlf04114  Oocyte meiosis
mlf04218  Cellular senescence
mlf04261  Adrenergic signaling in cardiomyocytes
mlf04270  Vascular smooth muscle contraction
mlf04371  Apelin signaling pathway
mlf04625  C-type lectin receptor signaling pathway
mlf04713  Circadian entrainment
mlf04720  Long-term potentiation
mlf04722  Neurotrophin signaling pathway
mlf04728  Dopaminergic synapse
mlf04740  Olfactory transduction
mlf04744  Phototransduction
mlf04750  Inflammatory mediator regulation of TRP channels
mlf04910  Insulin signaling pathway
mlf04912  GnRH signaling pathway
mlf04915  Estrogen signaling pathway
mlf04916  Melanogenesis
mlf04921  Oxytocin signaling pathway
mlf04922  Glucagon signaling pathway
mlf04924  Renin secretion
mlf04925  Aldosterone synthesis and secretion
mlf04970  Salivary secretion
mlf04971  Gastric acid secretion
mlf05010  Alzheimer disease
mlf05012  Parkinson disease
mlf05022  Pathways of neurodegeneration - multiple diseases
mlf05031  Amphetamine addiction
mlf05034  Alcoholism
mlf05133  Pertussis
mlf05152  Tuberculosis
mlf05163  Human cytomegalovirus infection
mlf05167  Kaposi sarcoma-associated herpesvirus infection
mlf05170  Human immunodeficiency virus 1 infection
mlf05200  Pathways in cancer
mlf05214  Glioma
mlf05417  Lipid and atherosclerosis
mlf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mlf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102419493
   04015 Rap1 signaling pathway
    102419493
   04371 Apelin signaling pathway
    102419493
   04020 Calcium signaling pathway
    102419493
   04070 Phosphatidylinositol signaling system
    102419493
   04024 cAMP signaling pathway
    102419493
   04022 cGMP-PKG signaling pathway
    102419493
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102419493
   04218 Cellular senescence
    102419493
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102419493
  09152 Endocrine system
   04910 Insulin signaling pathway
    102419493
   04922 Glucagon signaling pathway
    102419493
   04912 GnRH signaling pathway
    102419493
   04915 Estrogen signaling pathway
    102419493
   04921 Oxytocin signaling pathway
    102419493
   04916 Melanogenesis
    102419493
   04924 Renin secretion
    102419493
   04925 Aldosterone synthesis and secretion
    102419493
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102419493
   04270 Vascular smooth muscle contraction
    102419493
  09154 Digestive system
   04970 Salivary secretion
    102419493
   04971 Gastric acid secretion
    102419493
  09156 Nervous system
   04728 Dopaminergic synapse
    102419493
   04720 Long-term potentiation
    102419493
   04722 Neurotrophin signaling pathway
    102419493
  09157 Sensory system
   04744 Phototransduction
    102419493
   04740 Olfactory transduction
    102419493
   04750 Inflammatory mediator regulation of TRP channels
    102419493
  09159 Environmental adaptation
   04713 Circadian entrainment
    102419493
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102419493
  09162 Cancer: specific types
   05214 Glioma
    102419493
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102419493
   05163 Human cytomegalovirus infection
    102419493
   05167 Kaposi sarcoma-associated herpesvirus infection
    102419493
  09171 Infectious disease: bacterial
   05133 Pertussis
    102419493
   05152 Tuberculosis
    102419493
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102419493
   05012 Parkinson disease
    102419493
   05022 Pathways of neurodegeneration - multiple diseases
    102419493
  09165 Substance dependence
   05031 Amphetamine addiction
    102419493
   05034 Alcoholism
    102419493
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102419493
   05418 Fluid shear stress and atherosclerosis
    102419493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mlf01009]
    102419493
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mlf04131]
    102419493
   03036 Chromosome and associated proteins [BR:mlf03036]
    102419493
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlf04147]
    102419493
Protein phosphatases and associated proteins [BR:mlf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102419493
Membrane trafficking [BR:mlf04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102419493
Chromosome and associated proteins [BR:mlf03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102419493
Exosome [BR:mlf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102419493
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH Dockerin_1 EF_EFCAB10_C UPF0154 SPARC_Ca_bdg EF-hand_11 EF-hand_EFHB_C Caleosin DUF5580_M EFhand_Ca_insen SurA_N_3 DUF1103 dCache_2 Fe_hyd_lg_C RFC1
Other DBs
NCBI-GeneID: 102419493
NCBI-ProteinID: XP_006088486
Ensembl: ENSMLUG00000016375
UniProt: G1PUG5
LinkDB
Position
Unknown
AA seq 149 aa
MADQLTEEQLAEFREAFSLFDKDGDGTITTQELGTVMRALGQNPTQAELEAMVSEIDRDG
NGTVDFPEFLGMMARRMKDRDSEEEIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDQ
EVDEMIQAADVDGDGQVNYEEFVRMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagctgaccgaggagcagctggccgagtttagagaggccttctccctgttc
gacaaggacggggacggcaccatcaccacccaggagctgggcaccgtcatgcgggccctg
ggccagaaccccacgcaggccgagctcgaggccatggtgagcgagatagaccgcgatggc
aatggcaccgtggacttccctgagttcctgggcatgatggccaggcgcatgaaggacagg
gacagcgaggaggagatccgcgaggccttccgcgtgttcgacaaggacggcaacggcctg
gtcagtgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgaccag
gaggtggacgagatgatccaggcagccgatgtggatggggacgggcaggtcaactacgag
gagttcgtccgcatgctggtctccaagtga

DBGET integrated database retrieval system