Myotis lucifugus (little brown bat): 102419493 Help Entry 102419493         CDS       T07795                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04020   Calcium signaling pathway mlf04022   cGMP-PKG signaling pathway mlf04024   cAMP signaling pathway mlf04070   Phosphatidylinositol signaling system mlf04114   Oocyte meiosis mlf04218   Cellular senescence mlf04261   Adrenergic signaling in cardiomyocytes mlf04270   Vascular smooth muscle contraction mlf04371   Apelin signaling pathway mlf04625   C-type lectin receptor signaling pathway mlf04713   Circadian entrainment mlf04720   Long-term potentiation mlf04722   Neurotrophin signaling pathway mlf04728   Dopaminergic synapse mlf04740   Olfactory transduction mlf04744   Phototransduction mlf04750   Inflammatory mediator regulation of TRP channels mlf04910   Insulin signaling pathway mlf04912   GnRH signaling pathway mlf04915   Estrogen signaling pathway mlf04916   Melanogenesis mlf04921   Oxytocin signaling pathway mlf04922   Glucagon signaling pathway mlf04924   Renin secretion mlf04925   Aldosterone synthesis and secretion mlf04970   Salivary secretion mlf04971   Gastric acid secretion mlf05010   Alzheimer disease mlf05012   Parkinson disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05031   Amphetamine addiction mlf05034   Alcoholism mlf05133   Pertussis mlf05152   Tuberculosis mlf05163   Human cytomegalovirus infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05214   Glioma mlf05417   Lipid and atherosclerosis mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102419493    04015 Rap1 signaling pathway     102419493    04070 Phosphatidylinositol signaling system     102419493    04024 cAMP signaling pathway     102419493    04022 cGMP-PKG signaling pathway     102419493  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     102419493    04915 Estrogen signaling pathway     102419493    04921 Oxytocin signaling pathway     102419493    04924 Renin secretion     102419493    04925 Aldosterone synthesis and secretion     102419493   09154 Digestive system    04970 Salivary secretion     102419493    04971 Gastric acid secretion     102419493   09156 Nervous system    04728 Dopaminergic synapse     102419493    04720 Long-term potentiation     102419493    04722 Neurotrophin signaling pathway     102419493   09157 Sensory system    04740 Olfactory transduction     102419493    04750 Inflammatory mediator regulation of TRP channels     102419493   09159 Environmental adaptation    04713 Circadian entrainment     102419493  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102419493   09162 Cancer: specific types    05214 Glioma     102419493   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102419493    05163 Human cytomegalovirus infection     102419493    05167 Kaposi sarcoma-associated herpesvirus infection     102419493   09171 Infectious disease: bacterial    05133 Pertussis     102419493    05152 Tuberculosis     102419493   09164 Neurodegenerative disease    05010 Alzheimer disease     102419493    05012 Parkinson disease     102419493    05022 Pathways of neurodegeneration - multiple diseases     102419493   09165 Substance dependence    05031 Amphetamine addiction     102419493    05034 Alcoholism     102419493   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102419493    05418 Fluid shear stress and atherosclerosis     102419493  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlf01009]     102419493   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102419493    03036 Chromosome and associated proteins [BR:mlf03036]     102419493   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102419493 Protein phosphatases and associated proteins [BR:mlf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102419493 Membrane trafficking [BR:mlf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102419493 Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102419493 Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102419493 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH Dockerin_1 EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 Caleosin DUF5580_M EFhand_Ca_insen SurA_N_3 FCaBP_EF-hand DUF1103 HAD dCache_2 SurA_N_2 Fe_hyd_lg_C RFC1 Motif Other DBs NCBI-GeneID:  102419493 NCBI-ProteinID:  XP_006088486 Ensembl:  ENSMLUG00000016375 UniProt:  G1PUG5 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQLAEFREAFSLFDKDGDGTITTQELGTVMRALGQNPTQAELEAMVSEIDRDG NGTVDFPEFLGMMARRMKDRDSEEEIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDQ EVDEMIQAADVDGDGQVNYEEFVRMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgaccgaggagcagctggccgagtttagagaggccttctccctgttc gacaaggacggggacggcaccatcaccacccaggagctgggcaccgtcatgcgggccctg ggccagaaccccacgcaggccgagctcgaggccatggtgagcgagatagaccgcgatggc aatggcaccgtggacttccctgagttcctgggcatgatggccaggcgcatgaaggacagg gacagcgaggaggagatccgcgaggccttccgcgtgttcgacaaggacggcaacggcctg gtcagtgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgaccag gaggtggacgagatgatccaggcagccgatgtggatggggacgggcaggtcaactacgag gagttcgtccgcatgctggtctccaagtga

DBGET integrated database retrieval system