Myotis lucifugus (little brown bat): 102419640 Help Entry 102419640         CDS       T07795                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf00190   Oxidative phosphorylation mlf01100   Metabolic pathways mlf01524   Platinum drug resistance mlf04115   p53 signaling pathway mlf04210   Apoptosis mlf04215   Apoptosis - multiple species mlf04932   Non-alcoholic fatty liver disease mlf05010   Alzheimer disease mlf05012   Parkinson disease mlf05014   Amyotrophic lateral sclerosis mlf05016   Huntington disease mlf05017   Spinocerebellar ataxia mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05132   Salmonella infection mlf05134   Legionellosis mlf05145   Toxoplasmosis mlf05152   Tuberculosis mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05168   Herpes simplex virus 1 infection mlf05169   Epstein-Barr virus infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05210   Colorectal cancer mlf05222   Small cell lung cancer mlf05416   Viral myocarditis mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     102419640  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     102419640  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102419640   09162 Cancer: specific types    05210 Colorectal cancer     102419640    05222 Small cell lung cancer     102419640   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102419640    05161 Hepatitis B     102419640    05160 Hepatitis C     102419640    05164 Influenza A     102419640    05162 Measles     102419640    05163 Human cytomegalovirus infection     102419640    05167 Kaposi sarcoma-associated herpesvirus infection     102419640    05169 Epstein-Barr virus infection     102419640   09171 Infectious disease: bacterial    05134 Legionellosis     102419640    05152 Tuberculosis     102419640   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102419640   09164 Neurodegenerative disease    05010 Alzheimer disease     102419640    05012 Parkinson disease     102419640    05014 Amyotrophic lateral sclerosis     102419640    05016 Huntington disease     102419640    05017 Spinocerebellar ataxia     102419640    05020 Prion disease     102419640    05022 Pathways of neurodegeneration - multiple diseases     102419640   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102419640    05416 Viral myocarditis     102419640   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102419640   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102419640 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  102419640 NCBI-ProteinID:  XP_006100117 Ensembl:  ENSMLUG00000028154 UniProt:  G1Q5I9 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW GEATLMEYLENPKKYIPGTKMIFAGIKKSAERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctctttgggcgaaag acaggtcaggcccctggattttcttacacggatgccaacaagaacaaaggtatcacctgg ggtgaggctacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagagtgcagagagggcagacttgatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system