Myotis lucifugus (little brown bat): 102419808 Help Entry 102419808         CDS       T07795                                  Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04020   Calcium signaling pathway mlf04022   cGMP-PKG signaling pathway mlf04024   cAMP signaling pathway mlf04070   Phosphatidylinositol signaling system mlf04114   Oocyte meiosis mlf04218   Cellular senescence mlf04261   Adrenergic signaling in cardiomyocytes mlf04270   Vascular smooth muscle contraction mlf04371   Apelin signaling pathway mlf04625   C-type lectin receptor signaling pathway mlf04713   Circadian entrainment mlf04720   Long-term potentiation mlf04722   Neurotrophin signaling pathway mlf04728   Dopaminergic synapse mlf04740   Olfactory transduction mlf04744   Phototransduction mlf04750   Inflammatory mediator regulation of TRP channels mlf04910   Insulin signaling pathway mlf04912   GnRH signaling pathway mlf04915   Estrogen signaling pathway mlf04916   Melanogenesis mlf04921   Oxytocin signaling pathway mlf04922   Glucagon signaling pathway mlf04924   Renin secretion mlf04925   Aldosterone synthesis and secretion mlf04970   Salivary secretion mlf04971   Gastric acid secretion mlf05010   Alzheimer disease mlf05012   Parkinson disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05031   Amphetamine addiction mlf05034   Alcoholism mlf05133   Pertussis mlf05152   Tuberculosis mlf05163   Human cytomegalovirus infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05214   Glioma mlf05417   Lipid and atherosclerosis mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102419808    04015 Rap1 signaling pathway     102419808    04371 Apelin signaling pathway     102419808    04020 Calcium signaling pathway     102419808    04070 Phosphatidylinositol signaling system     102419808    04024 cAMP signaling pathway     102419808    04022 cGMP-PKG signaling pathway     102419808  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102419808    04218 Cellular senescence     102419808  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102419808   09152 Endocrine system    04910 Insulin signaling pathway     102419808    04922 Glucagon signaling pathway     102419808    04912 GnRH signaling pathway     102419808    04915 Estrogen signaling pathway     102419808    04921 Oxytocin signaling pathway     102419808    04916 Melanogenesis     102419808    04924 Renin secretion     102419808    04925 Aldosterone synthesis and secretion     102419808   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102419808    04270 Vascular smooth muscle contraction     102419808   09154 Digestive system    04970 Salivary secretion     102419808    04971 Gastric acid secretion     102419808   09156 Nervous system    04728 Dopaminergic synapse     102419808    04720 Long-term potentiation     102419808    04722 Neurotrophin signaling pathway     102419808   09157 Sensory system    04744 Phototransduction     102419808    04740 Olfactory transduction     102419808    04750 Inflammatory mediator regulation of TRP channels     102419808   09159 Environmental adaptation    04713 Circadian entrainment     102419808  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102419808   09162 Cancer: specific types    05214 Glioma     102419808   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102419808    05163 Human cytomegalovirus infection     102419808    05167 Kaposi sarcoma-associated herpesvirus infection     102419808   09171 Infectious disease: bacterial    05133 Pertussis     102419808    05152 Tuberculosis     102419808   09164 Neurodegenerative disease    05010 Alzheimer disease     102419808    05012 Parkinson disease     102419808    05022 Pathways of neurodegeneration - multiple diseases     102419808   09165 Substance dependence    05031 Amphetamine addiction     102419808    05034 Alcoholism     102419808   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102419808    05418 Fluid shear stress and atherosclerosis     102419808  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlf01009]     102419808   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102419808    03036 Chromosome and associated proteins [BR:mlf03036]     102419808   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102419808 Protein phosphatases and associated proteins [BR:mlf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102419808 Membrane trafficking [BR:mlf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102419808 Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102419808 Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102419808 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 Dockerin_1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C EH Temptin_C FCaBP_EF-hand PGM_PMM_III MTIP_N WEF-hand EF-hand_11 DUF5580_M GlutR_dimer Motif Other DBs NCBI-GeneID:  102419808 NCBI-ProteinID:  XP_006088487 UniProt:  G1P3W3 LinkDB All DBs Position Unknown AA seq 245 aa AA seqDB search MAPGSSPSLSRAGPATPIPAFLVCSWSVPPGRRILPEDVGWVGSLPPPFAPTAEKEGFPP LCKAAARALPSHRHSSSQPLVHSSDGSPLNWLAASDMAEELSKEQVADFKAAFTRFDKDG DGKINVEELGAVMKSLGQNPSEAELKELIARVDTDGDGAISFQEFLAEMVKRMKSWGGEQ DMKEVFRAFDLDGDGHITMDELKKAMAQIGQNLSQEDLEAMIREADVDKDGRVNYEEFSR ILSQK NT seq 738 nt NT seq  +upstreamnt  +downstreamnt atggccccaggtagctcccccagcctctccagggcgggccctgccactccaattcctgca tttcttgtctgcagctggtctgtccctcctgggaggaggattttgcctgaggatgtgggg tgggtggggagcctgcctcctccctttgctccgacagcagaaaaggaggggttcccaccc ctttgtaaggctgctgcccgagctctgccctcacacagacacagctcgtcccagccactg gtccacagttctgacgggagtcctttgaactggttggcagcaagcgacatggcagaggaa ctgtctaaagagcaggtggctgacttcaaggcagccttcaccaggttcgacaaggacggg gatggcaaaatcaacgtggaggagctgggcgccgtcatgaagtccctgggccagaaccca tcggaggccgagctgaaggagctcatcgcccgggtggacactgacggtgatggtgccatc agtttccaggagttcctggccgagatggtgaagaggatgaagtcctggggtggcgagcag gacatgaaggaggtcttccgagccttcgacctggacggcgatggccacatcacaatggac gagctcaagaaggccatggcccagatagggcagaatctctcccaggaggatctggaggcc atgatccgggaggcggacgtggacaaggatggccgggtgaactatgaggagttctcacga atactcagccagaagtga

DBGET integrated database retrieval system