Myotis lucifugus (little brown bat): 102421025 Help Entry 102421025         CDS       T07795                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf00190   Oxidative phosphorylation mlf01100   Metabolic pathways mlf01524   Platinum drug resistance mlf04115   p53 signaling pathway mlf04210   Apoptosis mlf04215   Apoptosis - multiple species mlf04932   Non-alcoholic fatty liver disease mlf05010   Alzheimer disease mlf05012   Parkinson disease mlf05014   Amyotrophic lateral sclerosis mlf05016   Huntington disease mlf05017   Spinocerebellar ataxia mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05132   Salmonella infection mlf05134   Legionellosis mlf05145   Toxoplasmosis mlf05152   Tuberculosis mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05168   Herpes simplex virus 1 infection mlf05169   Epstein-Barr virus infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05210   Colorectal cancer mlf05222   Small cell lung cancer mlf05416   Viral myocarditis mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     102421025  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102421025    04215 Apoptosis - multiple species     102421025    04115 p53 signaling pathway     102421025  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102421025   09162 Cancer: specific types    05210 Colorectal cancer     102421025    05222 Small cell lung cancer     102421025   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102421025    05161 Hepatitis B     102421025    05160 Hepatitis C     102421025    05164 Influenza A     102421025    05162 Measles     102421025    05168 Herpes simplex virus 1 infection     102421025    05163 Human cytomegalovirus infection     102421025    05167 Kaposi sarcoma-associated herpesvirus infection     102421025    05169 Epstein-Barr virus infection     102421025   09171 Infectious disease: bacterial    05132 Salmonella infection     102421025    05134 Legionellosis     102421025    05152 Tuberculosis     102421025   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102421025   09164 Neurodegenerative disease    05010 Alzheimer disease     102421025    05012 Parkinson disease     102421025    05014 Amyotrophic lateral sclerosis     102421025    05016 Huntington disease     102421025    05017 Spinocerebellar ataxia     102421025    05020 Prion disease     102421025    05022 Pathways of neurodegeneration - multiple diseases     102421025   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102421025    05416 Viral myocarditis     102421025   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102421025   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102421025 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 NCKAP5 Motif Other DBs NCBI-GeneID:  102421025 NCBI-ProteinID:  XP_006103342 Ensembl:  ENSMLUG00000028881 UniProt:  G1QAB6 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHSLFGRKTGQAPGFSYTDANKNKGITW GEATLMEYLENPKKYIPGTKMIFAGIKKSAERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaaagggaggcaagcacaagactgggccaaatctccacagtctatttgggcgaaag acaggtcaggcccctggattttcttacacggatgccaacaagaacaaaggtatcacctgg ggtgaggctacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggcattaagaagagcgcagagagggcagacttgatagcttatctcaaa aaagctactaatgagtaa

DBGET integrated database retrieval system